Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 3180330..3180544 | Replicon | chromosome |
Accession | NZ_CP019469 | ||
Organism | Clostridioides difficile strain LEM1 |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
Locus tag | BWD37_RS15540 | Protein ID | WP_003429855.1 |
Coordinates | 3180383..3180544 (-) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 3180330..3180463 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BWD37_RS15510 (3175877) | 3175877..3176029 | - | 153 | WP_021378619.1 | hypothetical protein | - |
BWD37_RS15515 (3176062) | 3176062..3176841 | - | 780 | WP_021391616.1 | ORF6N domain-containing protein | - |
BWD37_RS15520 (3177116) | 3177116..3177328 | + | 213 | WP_016728883.1 | helix-turn-helix transcriptional regulator | - |
BWD37_RS15525 (3177747) | 3177747..3177902 | - | 156 | WP_021378513.1 | hypothetical protein | - |
BWD37_RS15530 (3177954) | 3177954..3178820 | - | 867 | WP_021378510.1 | BRO family protein | - |
BWD37_RS15535 (3178939) | 3178939..3179127 | - | 189 | WP_003429858.1 | hypothetical protein | - |
- (3179881) | 3179881..3179986 | + | 106 | NuclAT_11 | - | - |
- (3179881) | 3179881..3179986 | + | 106 | NuclAT_6 | - | - |
- (3179881) | 3179881..3179986 | + | 106 | NuclAT_6 | - | - |
- (3179881) | 3179881..3179986 | + | 106 | NuclAT_9 | - | - |
- (3180330) | 3180330..3180463 | + | 134 | NuclAT_3 | - | Antitoxin |
- (3180330) | 3180330..3180463 | + | 134 | NuclAT_3 | - | Antitoxin |
- (3180330) | 3180330..3180463 | + | 134 | NuclAT_4 | - | Antitoxin |
- (3180330) | 3180330..3180463 | + | 134 | NuclAT_6 | - | Antitoxin |
BWD37_RS15540 (3180383) | 3180383..3180544 | - | 162 | WP_003429855.1 | hypothetical protein | Toxin |
BWD37_RS15545 (3180885) | 3180885..3181325 | - | 441 | WP_003429853.1 | phage portal protein | - |
BWD37_RS15550 (3181397) | 3181397..3181867 | - | 471 | WP_003429851.1 | phage tail tube protein | - |
BWD37_RS15555 (3181884) | 3181884..3183194 | - | 1311 | WP_021368245.1 | phage tail sheath family protein | - |
BWD37_RS15560 (3183196) | 3183196..3183372 | - | 177 | WP_021362376.1 | hypothetical protein | - |
BWD37_RS15565 (3183365) | 3183365..3183562 | - | 198 | WP_021400151.1 | hypothetical protein | - |
BWD37_RS15570 (3183577) | 3183577..3183801 | - | 225 | WP_261799548.1 | hypothetical protein | - |
BWD37_RS15575 (3183794) | 3183794..3184219 | - | 426 | WP_003429845.1 | HK97 gp10 family phage protein | - |
BWD37_RS15580 (3184219) | 3184219..3184566 | - | 348 | WP_003429844.1 | hypothetical protein | - |
BWD37_RS15585 (3184560) | 3184560..3184961 | - | 402 | WP_021379034.1 | hypothetical protein | - |
BWD37_RS15590 (3184971) | 3184971..3185204 | - | 234 | WP_003429842.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T72528 WP_003429855.1 NZ_CP019469:c3180544-3180383 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
>T72528 NZ_CP019469:c3180544-3180383 [Clostridioides difficile]
ATGAATAACTTTTTACTTAATGTAATAGCTGGCGTTATTGCTAGTTTAATATTTTGCTTAATTTGTAAAGTATTTCTAAA
AGTAAAAAGCCACTCAACTCGTGGCAAGAGTAAAAGTGGCTGGGAATTTGATTTTAAAATCAAGTTCCATAAGTTCAAAT
AG
ATGAATAACTTTTTACTTAATGTAATAGCTGGCGTTATTGCTAGTTTAATATTTTGCTTAATTTGTAAAGTATTTCTAAA
AGTAAAAAGCCACTCAACTCGTGGCAAGAGTAAAAGTGGCTGGGAATTTGATTTTAAAATCAAGTTCCATAAGTTCAAAT
AG
Antitoxin
Download Length: 134 bp
>AT72528 NZ_CP019469:3180330-3180463 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|