Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1908824..1909004 | Replicon | chromosome |
| Accession | NZ_CP018768 | ||
| Organism | Staphylococcus aureus strain UCI 28 isolate ST5 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | BSG37_RS15115 | Protein ID | WP_001801861.1 |
| Coordinates | 1908824..1908919 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1908947..1909004 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSG37_RS09540 | 1903987..1904637 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| BSG37_RS09545 | 1904718..1905713 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| BSG37_RS09550 | 1905788..1906414 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| BSG37_RS09555 | 1906455..1906796 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| BSG37_RS09560 | 1906897..1907469 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| BSG37_RS14985 | 1907667..1908679 | - | 1013 | Protein_1800 | IS3 family transposase | - |
| BSG37_RS15115 | 1908824..1908919 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1908947..1909004 | - | 58 | - | - | Antitoxin |
| BSG37_RS09575 | 1909042..1909143 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| BSG37_RS15120 | 1909121..1909282 | - | 162 | Protein_1803 | transposase | - |
| BSG37_RS09585 | 1909273..1909767 | - | 495 | Protein_1804 | transposase | - |
| BSG37_RS09590 | 1910219..1911448 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| BSG37_RS09595 | 1911441..1912997 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| BSG37_RS09600 | 1913161..1913295 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1903228..1935837 | 32609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T70430 WP_001801861.1 NZ_CP018768:1908824-1908919 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T70430 NZ_CP018768:1908824-1908919 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT70430 NZ_CP018768:c1909004-1908947 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|