Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1973324..1973504 | Replicon | chromosome |
Accession | NZ_CP018766 | ||
Organism | Staphylococcus aureus strain UCI62 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | BSG38_RS15625 | Protein ID | WP_001801861.1 |
Coordinates | 1973324..1973419 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1973447..1973504 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BSG38_RS10015 | 1968487..1969137 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
BSG38_RS10020 | 1969218..1970213 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
BSG38_RS10025 | 1970288..1970914 | + | 627 | WP_000669024.1 | hypothetical protein | - |
BSG38_RS10030 | 1970955..1971296 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
BSG38_RS10035 | 1971397..1971969 | + | 573 | WP_000414216.1 | hypothetical protein | - |
BSG38_RS15475 | 1972167..1973179 | - | 1013 | Protein_1882 | IS3 family transposase | - |
BSG38_RS15625 | 1973324..1973419 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1973447..1973504 | - | 58 | - | - | Antitoxin |
BSG38_RS10050 | 1973542..1973643 | + | 102 | WP_001792025.1 | hypothetical protein | - |
BSG38_RS15630 | 1973621..1973782 | - | 162 | Protein_1885 | transposase | - |
BSG38_RS10060 | 1973773..1974267 | - | 495 | Protein_1886 | transposase | - |
BSG38_RS10065 | 1974719..1975948 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
BSG38_RS10070 | 1975941..1977497 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
BSG38_RS10075 | 1977661..1977795 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1967728..2000336 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T70414 WP_001801861.1 NZ_CP018766:1973324-1973419 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T70414 NZ_CP018766:1973324-1973419 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT70414 NZ_CP018766:c1973504-1973447 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|