66746

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2564247..2564472 Replicon chromosome
Accession NZ_CP017446
Organism Escherichia coli O157:H7 strain 9234

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag A4C47_RS13330 Protein ID WP_000813258.1
Coordinates 2564317..2564472 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2564247..2564305 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A4C47_RS13280 2559312..2559554 + 243 WP_000747948.1 hypothetical protein -
A4C47_RS13285 2559538..2559963 + 426 WP_000693878.1 Rha family transcriptional regulator -
A4C47_RS30955 2560032..2561075 + 1044 WP_001262402.1 hypothetical protein -
A4C47_RS30960 2561068..2561529 + 462 WP_000139447.1 replication protein -
A4C47_RS13300 2561563..2562279 + 717 WP_000450627.1 DUF1627 domain-containing protein -
A4C47_RS13305 2562312..2562593 + 282 WP_000603384.1 DNA-binding protein -
A4C47_RS13310 2562590..2562817 + 228 WP_000699809.1 hypothetical protein -
A4C47_RS13315 2562810..2563121 + 312 WP_001289673.1 hypothetical protein -
A4C47_RS13320 2563249..2563467 + 219 WP_000683609.1 DUF4014 family protein -
A4C47_RS13325 2563469..2564026 + 558 WP_000104474.1 DUF551 domain-containing protein -
- 2564247..2564305 - 59 - - Antitoxin
A4C47_RS13330 2564317..2564472 + 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
A4C47_RS13335 2564592..2564936 + 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
A4C47_RS13340 2565058..2565330 + 273 WP_000191872.1 hypothetical protein -
A4C47_RS13345 2565332..2566381 + 1050 WP_001265229.1 DUF968 domain-containing protein -
A4C47_RS13350 2566394..2566699 + 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
A4C47_RS13355 2566762..2567316 + 555 WP_000640035.1 DUF1133 family protein -
A4C47_RS30965 2567541..2567738 + 198 WP_000917763.1 hypothetical protein -
A4C47_RS13365 2567874..2568587 + 714 WP_000301797.1 helix-turn-helix domain-containing protein -
A4C47_RS13380 2569042..2569470 + 429 WP_001303509.1 tellurite resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2495167..2608462 113295


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T66746 WP_000813258.1 NZ_CP017446:2564317-2564472 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T66746 NZ_CP017446:2564317-2564472 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT66746 NZ_CP017446:c2564305-2564247 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References