66576

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2565323..2565548 Replicon chromosome
Accession NZ_CP017436
Organism Escherichia coli O157:H7 strain 2149

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag A4C44_RS13335 Protein ID WP_000813258.1
Coordinates 2565393..2565548 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2565323..2565381 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A4C44_RS13285 2560388..2560630 + 243 WP_000747948.1 hypothetical protein -
A4C44_RS13290 2560614..2561039 + 426 WP_000693878.1 Rha family transcriptional regulator -
A4C44_RS30930 2561108..2562151 + 1044 WP_001262402.1 hypothetical protein -
A4C44_RS30935 2562144..2562605 + 462 WP_000139447.1 replication protein -
A4C44_RS13305 2562639..2563355 + 717 WP_000450627.1 DUF1627 domain-containing protein -
A4C44_RS13310 2563388..2563669 + 282 WP_000603384.1 DNA-binding protein -
A4C44_RS13315 2563666..2563893 + 228 WP_000699809.1 hypothetical protein -
A4C44_RS13320 2563886..2564197 + 312 WP_001289673.1 hypothetical protein -
A4C44_RS13325 2564325..2564543 + 219 WP_000683609.1 DUF4014 family protein -
A4C44_RS13330 2564545..2565102 + 558 WP_000104474.1 DUF551 domain-containing protein -
- 2565323..2565381 - 59 - - Antitoxin
A4C44_RS13335 2565393..2565548 + 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
A4C44_RS13340 2565668..2566012 + 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
A4C44_RS13345 2566134..2566406 + 273 WP_000191872.1 hypothetical protein -
A4C44_RS13350 2566408..2567457 + 1050 WP_001265229.1 DUF968 domain-containing protein -
A4C44_RS13355 2567470..2567775 + 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
A4C44_RS13360 2567838..2568392 + 555 WP_000640035.1 DUF1133 family protein -
A4C44_RS30940 2568617..2568814 + 198 WP_000917763.1 hypothetical protein -
A4C44_RS13370 2568950..2569663 + 714 WP_000301797.1 helix-turn-helix domain-containing protein -
A4C44_RS13385 2570118..2570546 + 429 WP_001303509.1 tellurite resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2506140..2603956 97816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T66576 WP_000813258.1 NZ_CP017436:2565393-2565548 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T66576 NZ_CP017436:2565393-2565548 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT66576 NZ_CP017436:c2565381-2565323 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References