Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1945963..1946143 | Replicon | chromosome |
Accession | NZ_CP017090 | ||
Organism | Staphylococcus aureus strain ISU935 isolate ST5 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | A2V17_RS14755 | Protein ID | WP_001801861.1 |
Coordinates | 1945963..1946058 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1946086..1946143 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A2V17_RS09760 | 1941126..1941776 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
A2V17_RS09765 | 1941857..1942852 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
A2V17_RS09770 | 1942927..1943553 | + | 627 | WP_000669024.1 | hypothetical protein | - |
A2V17_RS09775 | 1943594..1943935 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
A2V17_RS09780 | 1944036..1944608 | + | 573 | WP_000414216.1 | hypothetical protein | - |
A2V17_RS09785 | 1944806..1945818 | - | 1013 | Protein_1857 | IS3 family transposase | - |
A2V17_RS14755 | 1945963..1946058 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1946086..1946143 | - | 58 | - | - | Antitoxin |
A2V17_RS09790 | 1946181..1946282 | + | 102 | WP_001792025.1 | hypothetical protein | - |
A2V17_RS14760 | 1946260..1946421 | - | 162 | Protein_1860 | transposase | - |
A2V17_RS09795 | 1946412..1946906 | - | 495 | Protein_1861 | transposase | - |
A2V17_RS09800 | 1947358..1948587 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
A2V17_RS09805 | 1948580..1950136 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
A2V17_RS09810 | 1950300..1950434 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1941162..1981942 | 40780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65915 WP_001801861.1 NZ_CP017090:1945963-1946058 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65915 NZ_CP017090:1945963-1946058 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT65915 NZ_CP017090:c1946143-1946086 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|