Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 3337426..3337641 | Replicon | chromosome |
Accession | NZ_CP016318 | ||
Organism | Clostridioides difficile strain 630 delta erm |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | CDIF630erm_RS20760 | Protein ID | WP_011861731.1 |
Coordinates | 3337498..3337641 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 3337426..3337572 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF630erm_RS15700 | 3333085..3334239 | + | 1155 | WP_003439713.1 | GGDEF domain-containing protein | - |
CDIF630erm_RS15705 | 3334320..3336038 | - | 1719 | WP_011861730.1 | putative 2-aminoethylphosphonate ABC transporter permease subunit | - |
CDIF630erm_RS15710 | 3336043..3336924 | - | 882 | Protein_2956 | ATP-binding cassette domain-containing protein | - |
- | 3337426..3337572 | + | 147 | NuclAT_2 | - | Antitoxin |
- | 3337426..3337576 | + | 151 | NuclAT_1 | - | - |
CDIF630erm_RS20760 | 3337498..3337641 | - | 144 | WP_011861731.1 | hypothetical protein | Toxin |
CDIF630erm_RS15720 | 3337899..3338087 | + | 189 | WP_009898401.1 | hypothetical protein | - |
CDIF630erm_RS15725 | 3338334..3339038 | - | 705 | WP_011861732.1 | hypothetical protein | - |
CDIF630erm_RS15730 | 3339040..3339471 | - | 432 | WP_011861052.1 | protein-export chaperone SecB | - |
CDIF630erm_RS15735 | 3339489..3340085 | - | 597 | WP_011861051.1 | hypothetical protein | - |
CDIF630erm_RS15740 | 3340598..3340894 | - | 297 | WP_011861049.1 | hypothetical protein | - |
CDIF630erm_RS15745 | 3340911..3341726 | - | 816 | WP_011861048.1 | N-acetylmuramoyl-L-alanine amidase | - |
CDIF630erm_RS15750 | 3341723..3341983 | - | 261 | WP_011861047.1 | phage holin family protein | - |
CDIF630erm_RS15755 | 3342003..3342233 | - | 231 | WP_011861046.1 | hemolysin XhlA family protein | - |
CDIF630erm_RS15760 | 3342268..3342450 | - | 183 | WP_011861045.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T64415 WP_011861731.1 NZ_CP016318:c3337641-3337498 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
>T64415 NZ_CP016318:c3337641-3337498 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
Antitoxin
Download Length: 147 bp
>AT64415 NZ_CP016318:3337426-3337572 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|