Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2484455..2484657 | Replicon | chromosome |
Accession | NZ_CP016106 | ||
Organism | Clostridioides difficile strain DSM 29637 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | - |
Locus tag | CDIF29637_RS11905 | Protein ID | WP_021425031.1 |
Coordinates | 2484505..2484657 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2484455..2484584 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29637_RS11875 | 2480421..2480885 | + | 465 | WP_021401486.1 | hypothetical protein | - |
CDIF29637_RS11885 | 2481209..2481370 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF29637_RS19310 | 2481422..2482235 | - | 814 | Protein_2198 | toxin Bro | - |
CDIF29637_RS19315 | 2482356..2482508 | - | 153 | WP_021401405.1 | hypothetical protein | - |
CDIF29637_RS11900 | 2483389..2484311 | - | 923 | Protein_2200 | SHOCT domain-containing protein | - |
- | 2484455..2484584 | + | 130 | NuclAT_2 | - | Antitoxin |
CDIF29637_RS11905 | 2484505..2484657 | - | 153 | WP_021425031.1 | hypothetical protein | Toxin |
CDIF29637_RS11910 | 2484931..2485254 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF29637_RS11915 | 2485290..2485544 | - | 255 | WP_118701627.1 | hypothetical protein | - |
CDIF29637_RS11920 | 2485852..2486361 | - | 510 | Protein_2204 | transposase | - |
CDIF29637_RS11925 | 2486639..2487013 | - | 375 | Protein_2205 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29637_RS11930 | 2487118..2487492 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29637_RS11935 | 2488296..2488784 | + | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF29637_RS11940 | 2489173..2489343 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2476834..2494591 | 17757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5787.89 Da Isoelectric Point: 10.6365
>T64234 WP_021425031.1 NZ_CP016106:c2484657-2484505 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSAAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSAAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T64234 NZ_CP016106:c2484657-2484505 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGTAAGTTAATCAAAAA
AGTAAAAAGCCACTCTGCCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGTAAGTTAATCAAAAA
AGTAAAAAGCCACTCTGCCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT64234 NZ_CP016106:2484455-2484584 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGCAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGCAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|