Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1346446..1346651 | Replicon | chromosome |
Accession | NZ_CP016104 | ||
Organism | Clostridioides difficile strain DSM 29629 |
Toxin (Protein)
Gene name | CD1233.1 | Uniprot ID | A0A069A9H6 |
Locus tag | CDIF29629_RS06430 | Protein ID | WP_009896140.1 |
Coordinates | 1346446..1346598 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ808 | ||
Locus tag | - | ||
Coordinates | 1346578..1346651 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29629_RS06410 | 1341908..1342192 | - | 285 | WP_003419254.1 | sigma-70 family RNA polymerase sigma factor | - |
CDIF29629_RS06415 | 1342215..1343732 | - | 1518 | WP_070117367.1 | recombinase family protein | - |
CDIF29629_RS06420 | 1343857..1344678 | - | 822 | WP_070117369.1 | tetratricopeptide repeat protein | - |
CDIF29629_RS06425 | 1344869..1346296 | + | 1428 | WP_070117371.1 | cell wall-binding protein Cwp26 | - |
CDIF29629_RS06430 | 1346446..1346598 | + | 153 | WP_009896140.1 | hypothetical protein | Toxin |
- | 1346578..1346651 | - | 74 | NuclAT_8 | - | Antitoxin |
CDIF29629_RS06435 | 1348109..1348332 | - | 224 | Protein_1150 | helix-turn-helix transcriptional regulator | - |
CDIF29629_RS06440 | 1349034..1349189 | + | 156 | WP_038810520.1 | hypothetical protein | - |
CDIF29629_RS06450 | 1349435..1349686 | + | 252 | WP_074048076.1 | hypothetical protein | - |
CDIF29629_RS06470 | 1350904..1351287 | - | 384 | WP_070117374.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5811.96 Da Isoelectric Point: 11.1039
>T64221 WP_009896140.1 NZ_CP016104:1346446-1346598 [Clostridioides difficile]
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
Download Length: 153 bp
>T64221 NZ_CP016104:1346446-1346598 [Clostridioides difficile]
ATGGATAACTTTTTGTTTAATGTTTTAGCTAGTTTAACAGCTAGTGTGGTAGTTTACTTAATCAGTAAACTATTCAAAAA
AGCAAAAAGCCACTCTCGCACAAAGAGTGACTTACGAGTTGAATTTAAATTTATATTTAAATCCAAAAAATAA
ATGGATAACTTTTTGTTTAATGTTTTAGCTAGTTTAACAGCTAGTGTGGTAGTTTACTTAATCAGTAAACTATTCAAAAA
AGCAAAAAGCCACTCTCGCACAAAGAGTGACTTACGAGTTGAATTTAAATTTATATTTAAATCCAAAAAATAA
Antitoxin
Download Length: 74 bp
>AT64221 NZ_CP016104:c1346651-1346578 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|