63578

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2700813..2701038 Replicon chromosome
Accession NZ_CP015832
Organism Escherichia coli O157 strain 180-PT54

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag A8L39_RS14185 Protein ID WP_000813258.1
Coordinates 2700883..2701038 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2700813..2700871 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A8L39_RS14135 2695878..2696120 + 243 WP_000747948.1 hypothetical protein -
A8L39_RS14140 2696104..2696529 + 426 WP_000693878.1 Rha family transcriptional regulator -
A8L39_RS33735 2696598..2697641 + 1044 WP_001262402.1 hypothetical protein -
A8L39_RS32445 2697634..2698095 + 462 WP_000139447.1 replication protein -
A8L39_RS14155 2698129..2698845 + 717 WP_000450627.1 DUF1627 domain-containing protein -
A8L39_RS14160 2698878..2699159 + 282 WP_000603384.1 DNA-binding protein -
A8L39_RS14165 2699156..2699383 + 228 WP_000699809.1 hypothetical protein -
A8L39_RS14170 2699376..2699687 + 312 WP_001289673.1 hypothetical protein -
A8L39_RS14175 2699815..2700033 + 219 WP_000683609.1 DUF4014 family protein -
A8L39_RS14180 2700035..2700592 + 558 WP_000104474.1 DUF551 domain-containing protein -
- 2700813..2700871 - 59 - - Antitoxin
A8L39_RS14185 2700883..2701038 + 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
A8L39_RS14190 2701158..2701502 + 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
A8L39_RS14195 2701624..2701896 + 273 WP_000191872.1 hypothetical protein -
A8L39_RS14200 2701898..2702947 + 1050 WP_001265229.1 DUF968 domain-containing protein -
A8L39_RS14205 2702960..2703265 + 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
A8L39_RS14210 2703328..2703882 + 555 WP_000640035.1 DUF1133 family protein -
A8L39_RS33280 2704107..2704304 + 198 WP_000917763.1 hypothetical protein -
A8L39_RS14220 2704440..2705153 + 714 WP_000301797.1 helix-turn-helix domain-containing protein -
A8L39_RS14235 2705604..2706035 + 432 WP_001302123.1 tellurite resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2641866..2739931 98065


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T63578 WP_000813258.1 NZ_CP015832:2700883-2701038 [Escherichia coli O157]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T63578 NZ_CP015832:2700883-2701038 [Escherichia coli O157]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT63578 NZ_CP015832:c2700871-2700813 [Escherichia coli O157]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References