Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1908362..1908544 | Replicon | chromosome |
Accession | NZ_CP015447 | ||
Organism | Staphylococcus aureus strain M92 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | A6V38_RS09635 | Protein ID | WP_001801861.1 |
Coordinates | 1908362..1908457 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1908485..1908544 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6V38_RS09585 | 1904021..1904647 | + | 627 | WP_000669046.1 | hypothetical protein | - |
A6V38_RS09590 | 1904688..1905032 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
A6V38_RS09595 | 1905130..1905681 | + | 552 | WP_000414205.1 | hypothetical protein | - |
A6V38_RS09600 | 1905899..1906540 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
A6V38_RS09605 | 1906654..1906839 | - | 186 | WP_000809857.1 | hypothetical protein | - |
A6V38_RS09610 | 1906841..1907017 | - | 177 | WP_000375476.1 | hypothetical protein | - |
A6V38_RS09615 | 1907028..1907411 | - | 384 | WP_000070811.1 | hypothetical protein | - |
A6V38_RS09625 | 1908015..1908158 | - | 144 | WP_001549059.1 | transposase | - |
A6V38_RS09635 | 1908362..1908457 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1908485..1908544 | - | 60 | - | - | Antitoxin |
A6V38_RS09640 | 1908580..1908681 | + | 102 | WP_001791893.1 | hypothetical protein | - |
A6V38_RS09645 | 1908659..1908835 | - | 177 | Protein_1810 | transposase | - |
A6V38_RS09650 | 1909029..1909406 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1901461..1940381 | 38920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T63078 WP_001801861.1 NZ_CP015447:1908362-1908457 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T63078 NZ_CP015447:1908362-1908457 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT63078 NZ_CP015447:c1908544-1908485 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|