Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2547834..2548014 | Replicon | chromosome |
Accession | NZ_CP015173 | ||
Organism | Staphylococcus aureus strain RIVM6519 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | A5J11_RS14830 | Protein ID | WP_001801861.1 |
Coordinates | 2547834..2547929 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2547957..2548014 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A5J11_RS12625 | 2542997..2543647 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
A5J11_RS12630 | 2543728..2544723 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
A5J11_RS12635 | 2544798..2545424 | + | 627 | WP_000669024.1 | hypothetical protein | - |
A5J11_RS12640 | 2545465..2545806 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
A5J11_RS12645 | 2545907..2546479 | + | 573 | WP_000414216.1 | hypothetical protein | - |
A5J11_RS14615 | 2546677..2547689 | - | 1013 | Protein_2428 | IS3 family transposase | - |
A5J11_RS14830 | 2547834..2547929 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2547957..2548014 | - | 58 | - | - | Antitoxin |
A5J11_RS12665 | 2548052..2548153 | + | 102 | WP_001792025.1 | hypothetical protein | - |
A5J11_RS14835 | 2548131..2548292 | - | 162 | Protein_2431 | transposase | - |
A5J11_RS12670 | 2548283..2548777 | - | 495 | Protein_2432 | transposase | - |
A5J11_RS12675 | 2549229..2550458 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
A5J11_RS12680 | 2550451..2552007 | - | 1557 | WP_031862851.1 | type I restriction-modification system subunit M | - |
A5J11_RS12685 | 2552171..2552305 | - | 135 | WP_063125024.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 2542239..2574847 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T62588 WP_001801861.1 NZ_CP015173:2547834-2547929 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T62588 NZ_CP015173:2547834-2547929 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT62588 NZ_CP015173:c2548014-2547957 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|