Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1933155..1933337 | Replicon | chromosome |
Accession | NZ_CP014407 | ||
Organism | Staphylococcus aureus strain USA300-SUR12 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AYM25_RS15410 | Protein ID | WP_001801861.1 |
Coordinates | 1933155..1933250 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1933278..1933337 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM25_RS09830 | 1928815..1929441 | + | 627 | Protein_1845 | hypothetical protein | - |
AYM25_RS09835 | 1929482..1929826 | + | 345 | WP_077444006.1 | DUF3969 family protein | - |
AYM25_RS09840 | 1929924..1930475 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AYM25_RS09845 | 1930693..1931334 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AYM25_RS09850 | 1931448..1931633 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AYM25_RS09855 | 1931635..1931811 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AYM25_RS09860 | 1931822..1932205 | - | 384 | WP_000070811.1 | hypothetical protein | - |
AYM25_RS09870 | 1932809..1932952 | - | 144 | WP_001549059.1 | transposase | - |
AYM25_RS15410 | 1933155..1933250 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1933278..1933337 | - | 60 | - | - | Antitoxin |
AYM25_RS09875 | 1933373..1933474 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AYM25_RS09880 | 1933452..1933628 | - | 177 | Protein_1855 | transposase | - |
AYM25_RS09885 | 1933822..1934199 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1926255..1966426 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T61000 WP_001801861.1 NZ_CP014407:1933155-1933250 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T61000 NZ_CP014407:1933155-1933250 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT61000 NZ_CP014407:c1933337-1933278 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|