Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1953317..1953499 | Replicon | chromosome |
Accession | NZ_CP013957 | ||
Organism | Staphylococcus aureus strain V521 isolate Sequencing |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ASL17_RS17040 | Protein ID | WP_001801861.1 |
Coordinates | 1953317..1953412 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1953440..1953499 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASL17_RS09670 | 1948977..1949603 | + | 627 | WP_000669046.1 | hypothetical protein | - |
ASL17_RS09675 | 1949644..1949988 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
ASL17_RS09680 | 1950086..1950637 | + | 552 | WP_000414205.1 | hypothetical protein | - |
ASL17_RS09685 | 1950855..1951496 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
ASL17_RS09690 | 1951610..1951795 | - | 186 | WP_000809857.1 | hypothetical protein | - |
ASL17_RS09695 | 1951797..1951973 | - | 177 | WP_000375476.1 | hypothetical protein | - |
ASL17_RS09700 | 1951984..1952367 | - | 384 | WP_000070811.1 | hypothetical protein | - |
ASL17_RS09710 | 1952971..1953114 | - | 144 | WP_001549059.1 | transposase | - |
ASL17_RS17040 | 1953317..1953412 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1953440..1953499 | - | 60 | - | - | Antitoxin |
ASL17_RS09715 | 1953535..1953636 | + | 102 | WP_001791893.1 | hypothetical protein | - |
ASL17_RS16605 | 1953614..1953790 | - | 177 | Protein_1874 | transposase | - |
ASL17_RS09720 | 1953984..1954361 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1946417..1985337 | 38920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T59711 WP_001801861.1 NZ_CP013957:1953317-1953412 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T59711 NZ_CP013957:1953317-1953412 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT59711 NZ_CP013957:c1953499-1953440 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|