Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1996379..1996559 | Replicon | chromosome |
Accession | NZ_CP013953 | ||
Organism | Staphylococcus aureus strain NCCP14558 isolate sequencing |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ASL16_RS16080 | Protein ID | WP_001801861.1 |
Coordinates | 1996379..1996474 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1996502..1996559 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASL16_RS09870 | 1991542..1992192 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
ASL16_RS09875 | 1992273..1993268 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
ASL16_RS09880 | 1993343..1993969 | + | 627 | WP_000669024.1 | hypothetical protein | - |
ASL16_RS09885 | 1994010..1994351 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
ASL16_RS09890 | 1994452..1995024 | + | 573 | WP_000414216.1 | hypothetical protein | - |
ASL16_RS15655 | 1995222..1996234 | - | 1013 | Protein_1912 | IS3 family transposase | - |
ASL16_RS16080 | 1996379..1996474 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1996502..1996559 | - | 58 | - | - | Antitoxin |
ASL16_RS09910 | 1996597..1996698 | + | 102 | WP_001792025.1 | hypothetical protein | - |
ASL16_RS16085 | 1996676..1996837 | - | 162 | Protein_1915 | transposase | - |
ASL16_RS09915 | 1996828..1997322 | - | 495 | Protein_1916 | transposase | - |
ASL16_RS09920 | 1997774..1999003 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
ASL16_RS09925 | 1998996..2000552 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
ASL16_RS09930 | 2000716..2000850 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1990784..2025792 | 35008 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T59680 WP_001801861.1 NZ_CP013953:1996379-1996474 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T59680 NZ_CP013953:1996379-1996474 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT59680 NZ_CP013953:c1996559-1996502 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|