Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1963777..1964076 | Replicon | chromosome |
Accession | NZ_CP012974 | ||
Organism | Staphylococcus aureus strain ST20130943 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAST43_RS14375 | Protein ID | WP_011447039.1 |
Coordinates | 1963900..1964076 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1963777..1963832 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST43_RS09735 | 1959111..1959371 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAST43_RS09740 | 1959424..1959774 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
SAST43_RS09745 | 1960456..1960905 | + | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
SAST43_RS14695 | 1961000..1961335 | - | 336 | Protein_1838 | SH3 domain-containing protein | - |
SAST43_RS09755 | 1961985..1962476 | - | 492 | WP_000920037.1 | staphylokinase | - |
SAST43_RS09760 | 1962667..1963422 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAST43_RS09765 | 1963434..1963688 | - | 255 | WP_000611512.1 | phage holin | - |
SAST43_RS09770 | 1963740..1963847 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1963769..1963908 | + | 140 | NuclAT_0 | - | - |
- | 1963769..1963908 | + | 140 | NuclAT_0 | - | - |
- | 1963769..1963908 | + | 140 | NuclAT_0 | - | - |
- | 1963769..1963908 | + | 140 | NuclAT_0 | - | - |
- | 1963777..1963832 | + | 56 | - | - | Antitoxin |
SAST43_RS14375 | 1963900..1964076 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAST43_RS09775 | 1964226..1964522 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAST43_RS09780 | 1964580..1964867 | - | 288 | WP_062909805.1 | hypothetical protein | - |
SAST43_RS09785 | 1964914..1965066 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAST43_RS09790 | 1965056..1968841 | - | 3786 | WP_000582137.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / hlb / groEL | 1959424..2016333 | 56909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T57548 WP_011447039.1 NZ_CP012974:c1964076-1963900 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T57548 NZ_CP012974:c1964076-1963900 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT57548 NZ_CP012974:1963777-1963832 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|