Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2002831..2003011 | Replicon | chromosome |
Accession | NZ_CP012692 | ||
Organism | Staphylococcus aureus strain FORC_027 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FORC27_RS15820 | Protein ID | WP_001801861.1 |
Coordinates | 2002831..2002926 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2002954..2003011 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC27_RS10030 | 1997994..1998644 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
FORC27_RS10035 | 1998725..1999720 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
FORC27_RS10040 | 1999795..2000421 | + | 627 | WP_000669024.1 | hypothetical protein | - |
FORC27_RS10045 | 2000462..2000803 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
FORC27_RS10050 | 2000904..2001476 | + | 573 | WP_000414216.1 | hypothetical protein | - |
FORC27_RS15645 | 2001674..2002686 | - | 1013 | Protein_1942 | IS3 family transposase | - |
FORC27_RS15820 | 2002831..2002926 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2002954..2003011 | - | 58 | - | - | Antitoxin |
FORC27_RS10070 | 2003049..2003150 | + | 102 | WP_001792025.1 | hypothetical protein | - |
FORC27_RS15825 | 2003128..2003289 | - | 162 | Protein_1945 | transposase | - |
FORC27_RS10075 | 2003280..2003774 | - | 495 | Protein_1946 | transposase | - |
FORC27_RS10080 | 2004226..2005455 | - | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
FORC27_RS10085 | 2005448..2007004 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
FORC27_RS10090 | 2007168..2007302 | - | 135 | WP_069479482.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1997236..2029843 | 32607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T56989 WP_001801861.1 NZ_CP012692:2002831-2002926 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T56989 NZ_CP012692:2002831-2002926 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT56989 NZ_CP012692:c2003011-2002954 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|