Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2017139..2017321 | Replicon | chromosome |
Accession | NZ_CP012015 | ||
Organism | Staphylococcus aureus strain Gv51 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAGV51_RS16370 | Protein ID | WP_001801861.1 |
Coordinates | 2017139..2017234 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2017262..2017321 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAGV51_RS10100 | 2012799..2013425 | + | 627 | WP_000669046.1 | hypothetical protein | - |
SAGV51_RS10105 | 2013466..2013810 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
SAGV51_RS10110 | 2013908..2014459 | + | 552 | WP_000414205.1 | hypothetical protein | - |
SAGV51_RS10115 | 2014677..2015318 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAGV51_RS10120 | 2015432..2015617 | - | 186 | WP_000809857.1 | hypothetical protein | - |
SAGV51_RS10125 | 2015619..2015795 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAGV51_RS10130 | 2015806..2016189 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAGV51_RS10140 | 2016793..2016936 | - | 144 | WP_001549059.1 | transposase | - |
SAGV51_RS16370 | 2017139..2017234 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2017262..2017321 | - | 60 | - | - | Antitoxin |
SAGV51_RS10145 | 2017357..2017458 | + | 102 | WP_001791893.1 | hypothetical protein | - |
SAGV51_RS15940 | 2017436..2017612 | - | 177 | Protein_1967 | transposase | - |
SAGV51_RS10150 | 2017806..2018183 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
SAGV51_RS10155 | 2018704..2020029 | - | 1326 | Protein_1969 | ATP-binding protein | - |
SAGV51_RS10160 | 2020133..2021305 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 2010239..2050490 | 40251 | ||
- | flank | IS/Tn | - | - | 2020133..2021305 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T55491 WP_001801861.1 NZ_CP012015:2017139-2017234 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T55491 NZ_CP012015:2017139-2017234 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT55491 NZ_CP012015:c2017321-2017262 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|