Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2068592..2068774 | Replicon | chromosome |
Accession | NZ_CP012011 | ||
Organism | Staphylococcus aureus strain HC1340 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAHC1340_RS16770 | Protein ID | WP_001801861.1 |
Coordinates | 2068592..2068687 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2068715..2068774 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAHC1340_RS10470 | 2064252..2064878 | + | 627 | WP_000669046.1 | hypothetical protein | - |
SAHC1340_RS10475 | 2064919..2065263 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
SAHC1340_RS10480 | 2065361..2065912 | + | 552 | WP_000414205.1 | hypothetical protein | - |
SAHC1340_RS10485 | 2066130..2066771 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAHC1340_RS10490 | 2066885..2067070 | - | 186 | WP_000809857.1 | hypothetical protein | - |
SAHC1340_RS10495 | 2067072..2067248 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAHC1340_RS10500 | 2067259..2067642 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAHC1340_RS10510 | 2068246..2068389 | - | 144 | WP_001549059.1 | transposase | - |
SAHC1340_RS16770 | 2068592..2068687 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2068715..2068774 | - | 60 | - | - | Antitoxin |
SAHC1340_RS10515 | 2068810..2068911 | + | 102 | WP_001791893.1 | hypothetical protein | - |
SAHC1340_RS16320 | 2068889..2069065 | - | 177 | Protein_2038 | transposase | - |
SAHC1340_RS10520 | 2069259..2069636 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
SAHC1340_RS10525 | 2070140..2071312 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 2061692..2103274 | 41582 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T55423 WP_001801861.1 NZ_CP012011:2068592-2068687 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T55423 NZ_CP012011:2068592-2068687 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT55423 NZ_CP012011:c2068774-2068715 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|