Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1836533..1836713 | Replicon | chromosome |
Accession | NZ_CP011147 | ||
Organism | Staphylococcus aureus strain FCFHV36 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FCFHV36_RS16275 | Protein ID | WP_001801861.1 |
Coordinates | 1836533..1836628 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1836656..1836713 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FCFHV36_RS08835 | 1831696..1832346 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
FCFHV36_RS08840 | 1832427..1833422 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
FCFHV36_RS08845 | 1833497..1834123 | + | 627 | WP_000669024.1 | hypothetical protein | - |
FCFHV36_RS08850 | 1834164..1834505 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
FCFHV36_RS08855 | 1834606..1835178 | + | 573 | WP_000414216.1 | hypothetical protein | - |
FCFHV36_RS15415 | 1835376..1836388 | - | 1013 | Protein_1705 | IS3 family transposase | - |
FCFHV36_RS16275 | 1836533..1836628 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1836656..1836713 | - | 58 | - | - | Antitoxin |
FCFHV36_RS15420 | 1836751..1836852 | + | 102 | WP_001792025.1 | hypothetical protein | - |
FCFHV36_RS16280 | 1836830..1836991 | - | 162 | Protein_1708 | transposase | - |
FCFHV36_RS08880 | 1836982..1837476 | - | 495 | Protein_1709 | transposase | - |
FCFHV36_RS08885 | 1837928..1839157 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
FCFHV36_RS08890 | 1839150..1840706 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
FCFHV36_RS15425 | 1840870..1841004 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1830937..1871635 | 40698 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T53562 WP_001801861.1 NZ_CP011147:1836533-1836628 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T53562 NZ_CP011147:1836533-1836628 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT53562 NZ_CP011147:c1836713-1836656 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|