Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1685781..1685996 | Replicon | chromosome |
Accession | NZ_CP010888 | ||
Organism | Clostridioides difficile strain 08ACD0030 |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | TW87_RS08055 | Protein ID | WP_011861731.1 |
Coordinates | 1685781..1685924 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 1685846..1685996 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TW87_RS08030 | 1681438..1681800 | + | 363 | WP_015984864.1 | hypothetical protein | - |
TW87_RS08035 | 1681966..1682484 | + | 519 | WP_009898407.1 | hypothetical protein | - |
TW87_RS08040 | 1682548..1684134 | - | 1587 | WP_015984865.1 | hypothetical protein | - |
TW87_RS08045 | 1684110..1684631 | - | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
TW87_RS08050 | 1685333..1685521 | - | 189 | WP_009898401.1 | hypothetical protein | - |
TW87_RS08055 | 1685781..1685924 | + | 144 | WP_011861731.1 | hypothetical protein | Toxin |
- | 1685846..1685996 | - | 151 | NuclAT_1 | - | Antitoxin |
- | 1685850..1685996 | - | 147 | NuclAT_0 | - | - |
TW87_RS08060 | 1686431..1686808 | + | 378 | WP_021391346.1 | BlaI/MecI/CopY family transcriptional regulator | - |
TW87_RS08065 | 1686918..1687301 | + | 384 | WP_015984867.1 | BlaI/MecI/CopY family transcriptional regulator | - |
TW87_RS08070 | 1687486..1688070 | + | 585 | Protein_1481 | GntR family transcriptional regulator | - |
TW87_RS08075 | 1688096..1688509 | + | 414 | WP_009896035.1 | PTS sugar transporter subunit IIA | - |
TW87_RS08080 | 1688513..1689256 | + | 744 | WP_003437997.1 | membrane complex biogenesis protein, BtpA family | - |
TW87_RS08085 | 1689256..1689726 | + | 471 | WP_003428544.1 | PTS sugar transporter subunit IIB | - |
TW87_RS08090 | 1689743..1690501 | + | 759 | WP_009888882.1 | PTS sugar transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1627875..1708027 | 80152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T53029 WP_011861731.1 NZ_CP010888:1685781-1685924 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
>T53029 NZ_CP010888:1685781-1685924 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
Antitoxin
Download Length: 151 bp
>AT53029 NZ_CP010888:c1685996-1685846 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|