Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1929115..1929297 | Replicon | chromosome |
| Accession | NZ_CP010298 | ||
| Organism | Staphylococcus aureus strain ATCC BAA1680 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RM31_RS15405 | Protein ID | WP_001801861.1 |
| Coordinates | 1929115..1929210 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1929238..1929297 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RM31_RS15545 | 1924361..1924699 | + | 339 | WP_173401752.1 | hypothetical protein | - |
| RM31_RS08840 | 1924775..1925401 | + | 627 | Protein_1842 | hypothetical protein | - |
| RM31_RS08845 | 1925442..1925786 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| RM31_RS08850 | 1925884..1926435 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| RM31_RS08855 | 1926653..1927294 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RM31_RS08860 | 1927408..1927593 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| RM31_RS14555 | 1927595..1927771 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| RM31_RS08870 | 1927782..1928165 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| RM31_RS14565 | 1928769..1928912 | - | 144 | WP_001549059.1 | transposase | - |
| RM31_RS15405 | 1929115..1929210 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1929238..1929297 | - | 60 | - | - | Antitoxin |
| RM31_RS14570 | 1929333..1929434 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| RM31_RS14575 | 1929412..1929588 | - | 177 | Protein_1852 | transposase | - |
| RM31_RS08880 | 1929782..1930159 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1922214..1962386 | 40172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T51885 WP_001801861.1 NZ_CP010298:1929115-1929210 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T51885 NZ_CP010298:1929115-1929210 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT51885 NZ_CP010298:c1929297-1929238 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|