Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1910887..1911069 | Replicon | chromosome |
Accession | NZ_CP007670 | ||
Organism | Staphylococcus aureus strain M121 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EP54_RS17000 | Protein ID | WP_001801861.1 |
Coordinates | 1910887..1910982 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1911010..1911069 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EP54_RS09470 | 1906547..1907173 | + | 627 | WP_000669046.1 | hypothetical protein | - |
EP54_RS09475 | 1907214..1907558 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
EP54_RS09480 | 1907656..1908207 | + | 552 | WP_000414205.1 | hypothetical protein | - |
EP54_RS09485 | 1908425..1909066 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
EP54_RS09490 | 1909180..1909365 | - | 186 | WP_000809857.1 | hypothetical protein | - |
EP54_RS16145 | 1909367..1909543 | - | 177 | WP_000375476.1 | hypothetical protein | - |
EP54_RS09500 | 1909554..1909937 | - | 384 | WP_000070811.1 | hypothetical protein | - |
EP54_RS16155 | 1910541..1910684 | - | 144 | WP_001549059.1 | transposase | - |
EP54_RS17000 | 1910887..1910982 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1911010..1911069 | - | 60 | - | - | Antitoxin |
EP54_RS16160 | 1911105..1911206 | + | 102 | WP_001791893.1 | hypothetical protein | - |
EP54_RS16165 | 1911184..1911360 | - | 177 | Protein_1825 | transposase | - |
EP54_RS09520 | 1911554..1911931 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1903987..1944157 | 40170 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46822 WP_001801861.1 NZ_CP007670:1910887-1910982 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46822 NZ_CP007670:1910887-1910982 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46822 NZ_CP007670:c1911069-1911010 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|