Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2042431..2042611 | Replicon | chromosome |
Accession | NZ_CP007454 | ||
Organism | Staphylococcus aureus strain 502A isolate RN6607 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CH52_RS14925 | Protein ID | WP_001801861.1 |
Coordinates | 2042516..2042611 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2042431..2042488 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CH52_RS10555 | 2038140..2038274 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CH52_RS10560 | 2038438..2039994 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CH52_RS10565 | 2039987..2041216 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CH52_RS10570 | 2041668..2042162 | + | 495 | Protein_1991 | transposase | - |
CH52_RS14920 | 2042153..2042314 | + | 162 | Protein_1992 | transposase | - |
CH52_RS10575 | 2042292..2042393 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 2042431..2042488 | + | 58 | - | - | Antitoxin |
CH52_RS14925 | 2042516..2042611 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CH52_RS14705 | 2042756..2043768 | + | 1013 | Protein_1995 | IS3 family transposase | - |
CH52_RS10595 | 2043966..2044538 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CH52_RS10600 | 2044639..2044980 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CH52_RS10605 | 2045021..2045647 | - | 627 | WP_000669024.1 | hypothetical protein | - |
CH52_RS10610 | 2045722..2046717 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CH52_RS10615 | 2046798..2047448 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 2015598..2048206 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46481 WP_001801861.1 NZ_CP007454:c2042611-2042516 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46481 NZ_CP007454:c2042611-2042516 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT46481 NZ_CP007454:2042431-2042488 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|