Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2061565..2061790 Replicon chromosome
Accession NZ_AP026087
Organism Escherichia coli strain 8_140198

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag OO841_RS10275 Protein ID WP_000813258.1
Coordinates 2061565..2061720 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2061732..2061790 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO841_RS10225 2056568..2056999 - 432 WP_001302123.1 tellurite resistance protein -
OO841_RS10240 2057450..2058163 - 714 WP_000301797.1 helix-turn-helix domain-containing protein -
OO841_RS10245 2058299..2058496 - 198 WP_000917763.1 hypothetical protein -
OO841_RS10250 2058721..2059275 - 555 WP_000640035.1 DUF1133 family protein -
OO841_RS10255 2059338..2059643 - 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
OO841_RS10260 2059656..2060705 - 1050 WP_001265229.1 DUF968 domain-containing protein -
OO841_RS10265 2060707..2060979 - 273 WP_000191872.1 hypothetical protein -
OO841_RS10270 2061101..2061445 - 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
OO841_RS10275 2061565..2061720 - 156 WP_000813258.1 Hok/Gef family protein Toxin
- 2061732..2061790 + 59 - - Antitoxin
OO841_RS10280 2062011..2062568 - 558 WP_000104474.1 DUF551 domain-containing protein -
OO841_RS10285 2062570..2062788 - 219 WP_000683609.1 DUF4014 family protein -
OO841_RS10290 2062916..2063227 - 312 WP_001289673.1 hypothetical protein -
OO841_RS10295 2063220..2063447 - 228 WP_000699809.1 hypothetical protein -
OO841_RS10300 2063444..2063725 - 282 WP_000603384.1 DNA-binding protein -
OO841_RS10305 2063758..2064474 - 717 WP_000450627.1 DUF1627 domain-containing protein -
OO841_RS10310 2064508..2064969 - 462 WP_000139447.1 replication protein P -
OO841_RS10315 2064962..2066005 - 1044 WP_001262402.1 DnaT-like ssDNA-binding domain-containing protein -
OO841_RS10320 2066074..2066499 - 426 WP_000693878.1 toxin YdaT family protein -
OO841_RS10325 2066483..2066725 - 243 WP_000747948.1 Cro/CI family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2031110..2122460 91350


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T41921 WP_000813258.1 NZ_AP026087:c2061720-2061565 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T41921 NZ_AP026087:c2061720-2061565 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT41921 NZ_AP026087:2061732-2061790 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References