Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1298390..1298615 | Replicon | chromosome |
Accession | NZ_AP026087 | ||
Organism | Escherichia coli strain 8_140198 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | OO841_RS06270 | Protein ID | WP_000813258.1 |
Coordinates | 1298390..1298545 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1298557..1298615 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO841_RS06265 | 1297926..1298270 | - | 345 | WP_000756595.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
OO841_RS06270 | 1298390..1298545 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 1298557..1298615 | + | 59 | - | - | Antitoxin |
OO841_RS06275 | 1298836..1299231 | - | 396 | WP_000426668.1 | hypothetical protein | - |
OO841_RS06280 | 1299231..1300129 | - | 899 | Protein_1226 | ead/Ea22-like family protein | - |
OO841_RS06285 | 1300116..1300400 | - | 285 | WP_001024844.1 | DUF4752 family protein | - |
OO841_RS06290 | 1300397..1300618 | - | 222 | WP_000763353.1 | TraR/DksA family transcriptional regulator | - |
OO841_RS06295 | 1300666..1301295 | - | 630 | WP_000203825.1 | antA/AntB antirepressor family protein | - |
OO841_RS06300 | 1302254..1302361 | + | 108 | WP_001273654.1 | KGG domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | stx2A / stx2B | 1238746..1303772 | 65026 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T41915 WP_000813258.1 NZ_AP026087:c1298545-1298390 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T41915 NZ_AP026087:c1298545-1298390 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT41915 NZ_AP026087:1298557-1298615 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|