Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2800537..2800746 | Replicon | chromosome |
Accession | NZ_AP025558 | ||
Organism | Clostridioides difficile strain CE91-St50 |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | - |
Locus tag | MWL96_RS13030 | Protein ID | WP_003431040.1 |
Coordinates | 2800588..2800746 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 2800537..2800671 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MWL96_RS13000 (2795740) | 2795740..2795940 | + | 201 | WP_003431034.1 | cold-shock protein | - |
MWL96_RS13005 (2796386) | 2796386..2797708 | + | 1323 | WP_021427477.1 | ATP-binding protein | - |
MWL96_RS13010 (2797751) | 2797751..2798332 | + | 582 | WP_003431036.1 | accessory gene regulator B family protein | - |
MWL96_RS13015 (2798350) | 2798350..2798511 | + | 162 | WP_003431037.1 | cyclic lactone autoinducer peptide | - |
MWL96_RS13020 (2798533) | 2798533..2799330 | - | 798 | WP_003431038.1 | N-acetylmuramoyl-L-alanine amidase | - |
MWL96_RS13025 (2799327) | 2799327..2799587 | - | 261 | WP_003431039.1 | phage holin family protein | - |
- (2800537) | 2800537..2800671 | + | 135 | NuclAT_0 | - | Antitoxin |
- (2800537) | 2800537..2800671 | + | 135 | NuclAT_0 | - | Antitoxin |
- (2800537) | 2800537..2800671 | + | 135 | NuclAT_0 | - | Antitoxin |
MWL96_RS13030 (2800588) | 2800588..2800746 | - | 159 | WP_003431040.1 | hypothetical protein | Toxin |
MWL96_RS13035 (2801104) | 2801104..2802474 | - | 1371 | WP_003431041.1 | cell wall-binding protein Cwp29 | - |
MWL96_RS13045 (2802909) | 2802909..2803295 | + | 387 | WP_231299769.1 | hypothetical protein | - |
MWL96_RS13050 (2803673) | 2803673..2803798 | + | 126 | WP_003431043.1 | hypothetical protein | - |
MWL96_RS13055 (2804161) | 2804161..2804241 | - | 81 | Protein_2517 | VOC family protein | - |
MWL96_RS13060 (2804281) | 2804281..2804949 | - | 669 | WP_003431044.1 | VanZ family protein | - |
MWL96_RS13065 (2805048) | 2805048..2805431 | - | 384 | WP_071599195.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5982.18 Da Isoelectric Point: 11.3102
>T40423 WP_003431040.1 NZ_AP025558:c2800746-2800588 [Clostridioides difficile]
MDNFLQGILASLSASLIVYVASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYVASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
>T40423 NZ_AP025558:c2800746-2800588 [Clostridioides difficile]
ATGGATAATTTTTTACAAGGCATACTAGCAAGTCTATCTGCTAGCTTAATAGTTTATGTAGCTAGCAAACTATTTAGAAA
GCGTAAAAAACCACTCAAAGCGGCAACTAAGAGTGGTTGGGAATTTGATTTAAAAATCAGATTCCATAAAACTAAGTAA
ATGGATAATTTTTTACAAGGCATACTAGCAAGTCTATCTGCTAGCTTAATAGTTTATGTAGCTAGCAAACTATTTAGAAA
GCGTAAAAAACCACTCAAAGCGGCAACTAAGAGTGGTTGGGAATTTGATTTAAAAATCAGATTCCATAAAACTAAGTAA
Antitoxin
Download Length: 135 bp
>AT40423 NZ_AP025558:2800537-2800671 [Clostridioides difficile]
AAGAAGAGCTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAGCTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|