Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1931507..1931689 | Replicon | chromosome |
| Accession | NZ_AP024742 | ||
| Organism | Staphylococcus aureus strain 59736 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OCX51_RS09415 | Protein ID | WP_001801861.1 |
| Coordinates | 1931507..1931602 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1931630..1931689 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCX51_RS09380 | 1927177..1927803 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| OCX51_RS09385 | 1927844..1928185 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| OCX51_RS09390 | 1928286..1928858 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| OCX51_RS09395 | 1929056..1929684 | - | 629 | Protein_1849 | ImmA/IrrE family metallo-endopeptidase | - |
| OCX51_RS09400 | 1929987..1930163 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| OCX51_RS09405 | 1930174..1930557 | - | 384 | Protein_1851 | hypothetical protein | - |
| OCX51_RS09410 | 1931161..1931304 | - | 144 | WP_001549059.1 | transposase | - |
| OCX51_RS09415 | 1931507..1931602 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1931630..1931689 | - | 60 | - | - | Antitoxin |
| OCX51_RS09420 | 1931725..1931826 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| OCX51_RS09425 | 1931804..1931980 | - | 177 | Protein_1855 | transposase | - |
| OCX51_RS09430 | 1932174..1932551 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1924826..1964793 | 39967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39407 WP_001801861.1 NZ_AP024742:1931507-1931602 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39407 NZ_AP024742:1931507-1931602 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39407 NZ_AP024742:c1931689-1931630 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|