Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1937477..1937659 | Replicon | chromosome |
Accession | NZ_AP024734 | ||
Organism | Staphylococcus aureus strain 59691 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OCX19_RS09475 | Protein ID | WP_001801861.1 |
Coordinates | 1937477..1937572 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1937600..1937659 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX19_RS09435 | 1933147..1933773 | + | 627 | WP_000669017.1 | hypothetical protein | - |
OCX19_RS09440 | 1933814..1934155 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
OCX19_RS09445 | 1934256..1934828 | + | 573 | WP_000414202.1 | hypothetical protein | - |
OCX19_RS09450 | 1935026..1935654 | - | 629 | Protein_1861 | ImmA/IrrE family metallo-endopeptidase | - |
OCX19_RS09455 | 1935769..1935939 | - | 171 | WP_169301139.1 | hypothetical protein | - |
OCX19_RS09460 | 1935957..1936133 | - | 177 | WP_000375477.1 | hypothetical protein | - |
OCX19_RS09465 | 1936144..1936527 | - | 384 | Protein_1864 | hypothetical protein | - |
OCX19_RS09470 | 1937131..1937274 | - | 144 | WP_261921429.1 | transposase | - |
OCX19_RS09475 | 1937477..1937572 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1937600..1937659 | - | 60 | - | - | Antitoxin |
OCX19_RS09480 | 1937695..1937796 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OCX19_RS09485 | 1937774..1937950 | - | 177 | Protein_1868 | transposase | - |
OCX19_RS09490 | 1938144..1938521 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1931383..1970762 | 39379 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39347 WP_001801861.1 NZ_AP024734:1937477-1937572 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39347 NZ_AP024734:1937477-1937572 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39347 NZ_AP024734:c1937659-1937600 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|