Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1927067..1927249 | Replicon | chromosome |
Accession | NZ_AP024723 | ||
Organism | Staphylococcus aureus strain 59458 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OCX22_RS09405 | Protein ID | WP_001801861.1 |
Coordinates | 1927067..1927162 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1927190..1927249 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX22_RS09365 | 1922738..1923364 | + | 627 | WP_000669017.1 | hypothetical protein | - |
OCX22_RS09370 | 1923405..1923746 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
OCX22_RS09375 | 1923847..1924419 | + | 573 | WP_000414202.1 | hypothetical protein | - |
OCX22_RS09380 | 1924617..1925245 | - | 629 | Protein_1846 | ImmA/IrrE family metallo-endopeptidase | - |
OCX22_RS09385 | 1925360..1925545 | - | 186 | WP_261921410.1 | hypothetical protein | - |
OCX22_RS09390 | 1925547..1925723 | - | 177 | WP_000375477.1 | hypothetical protein | - |
OCX22_RS09395 | 1925734..1926117 | - | 384 | Protein_1849 | hypothetical protein | - |
OCX22_RS09400 | 1926721..1926864 | - | 144 | WP_001549059.1 | transposase | - |
OCX22_RS09405 | 1927067..1927162 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1927190..1927249 | - | 60 | - | - | Antitoxin |
OCX22_RS09410 | 1927285..1927386 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OCX22_RS09415 | 1927364..1927540 | - | 177 | Protein_1853 | transposase | - |
OCX22_RS09420 | 1927734..1928111 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1920974..1960307 | 39333 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39256 WP_001801861.1 NZ_AP024723:1927067-1927162 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39256 NZ_AP024723:1927067-1927162 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39256 NZ_AP024723:c1927249-1927190 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|