Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 214212..214392 | Replicon | chromosome |
| Accession | NZ_AP024511 | ||
| Organism | Staphylococcus aureus isolate 2007-13 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | KJS82_RS01385 | Protein ID | WP_001801861.1 |
| Coordinates | 214297..214392 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 214212..214269 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJS82_RS01355 | 209921..210055 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| KJS82_RS01360 | 210219..211775 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| KJS82_RS01365 | 211768..212997 | + | 1230 | WP_213607948.1 | restriction endonuclease subunit S | - |
| KJS82_RS01370 | 213539..213949 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
| KJS82_RS01375 | 213934..214095 | + | 162 | Protein_238 | transposase | - |
| KJS82_RS01380 | 214073..214174 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 214212..214269 | + | 58 | - | - | Antitoxin |
| KJS82_RS01385 | 214297..214392 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| KJS82_RS01390 | 214537..215549 | + | 1013 | Protein_241 | IS3 family transposase | - |
| KJS82_RS01395 | 215747..216319 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| KJS82_RS01400 | 216420..216761 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| KJS82_RS01405 | 216802..217428 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| KJS82_RS01410 | 217503..218498 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| KJS82_RS01415 | 218579..219229 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selk / hlgA / lukD | 187381..219193 | 31812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T38521 WP_001801861.1 NZ_AP024511:c214392-214297 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T38521 NZ_AP024511:c214392-214297 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT38521 NZ_AP024511:214212-214269 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|