Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1895242..1895422 | Replicon | chromosome |
Accession | NZ_AP024170 | ||
Organism | Staphylococcus aureus strain 834 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SA834_RS09095 | Protein ID | WP_001801861.1 |
Coordinates | 1895242..1895337 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1895365..1895422 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA834_RS09065 | 1890405..1891055 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
SA834_RS09070 | 1891136..1892131 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
SA834_RS09075 | 1892206..1892832 | + | 627 | WP_000669024.1 | hypothetical protein | - |
SA834_RS09080 | 1892873..1893214 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
SA834_RS09085 | 1893315..1893887 | + | 573 | WP_000414216.1 | hypothetical protein | - |
SA834_RS09090 | 1894085..1895097 | - | 1013 | Protein_1791 | IS3 family transposase | - |
SA834_RS09095 | 1895242..1895337 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1895365..1895422 | - | 58 | - | - | Antitoxin |
SA834_RS09100 | 1895460..1895561 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SA834_RS09105 | 1895539..1895700 | - | 162 | Protein_1794 | transposase | - |
SA834_RS09110 | 1895691..1896185 | - | 495 | Protein_1795 | transposase | - |
SA834_RS09115 | 1896637..1897866 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
SA834_RS09120 | 1897859..1899415 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
SA834_RS09125 | 1899579..1899713 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1890441..1931220 | 40779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T38067 WP_001801861.1 NZ_AP024170:1895242-1895337 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T38067 NZ_AP024170:1895242-1895337 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT38067 NZ_AP024170:c1895422-1895365 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|