Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 173064..173244 | Replicon | chromosome |
Accession | NZ_AP020320 | ||
Organism | Staphylococcus aureus strain KUH180062 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | F6Y17_RS01115 | Protein ID | WP_001801861.1 |
Coordinates | 173149..173244 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 173064..173121 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6Y17_RS01085 | 168773..168907 | + | 135 | WP_001791797.1 | hypothetical protein | - |
F6Y17_RS01090 | 169071..170627 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
F6Y17_RS01095 | 170620..171849 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
F6Y17_RS01100 | 172301..172795 | + | 495 | Protein_175 | transposase | - |
F6Y17_RS01105 | 172786..172947 | + | 162 | Protein_176 | transposase | - |
F6Y17_RS01110 | 172925..173026 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 173064..173121 | + | 58 | - | - | Antitoxin |
F6Y17_RS01115 | 173149..173244 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
F6Y17_RS01120 | 173389..174401 | + | 1013 | Protein_179 | IS3 family transposase | - |
F6Y17_RS01125 | 174599..175171 | - | 573 | WP_000414216.1 | hypothetical protein | - |
F6Y17_RS01130 | 175272..175613 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
F6Y17_RS01135 | 175654..176280 | - | 627 | WP_000669024.1 | hypothetical protein | - |
F6Y17_RS01140 | 176355..177350 | - | 996 | WP_150030548.1 | DUF4352 domain-containing protein | - |
F6Y17_RS01145 | 177431..178081 | - | 651 | WP_001838777.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 146231..178839 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T33299 WP_001801861.1 NZ_AP020320:c173244-173149 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T33299 NZ_AP020320:c173244-173149 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT33299 NZ_AP020320:173064-173121 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|