Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1961881..1962063 | Replicon | chromosome |
| Accession | NZ_AP019751 | ||
| Organism | Staphylococcus aureus strain JRA307 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FPG46_RS09825 | Protein ID | WP_001801861.1 |
| Coordinates | 1961881..1961976 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1962004..1962063 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FPG46_RS09775 | 1957551..1958177 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| FPG46_RS09780 | 1958218..1958559 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| FPG46_RS09785 | 1958660..1959232 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| FPG46_RS09790 | 1959430..1959987 | - | 558 | Protein_1882 | ImmA/IrrE family metallo-endopeptidase | - |
| FPG46_RS09800 | 1960361..1960537 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| FPG46_RS09805 | 1960548..1960931 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| FPG46_RS09815 | 1961535..1961678 | - | 144 | WP_001549059.1 | transposase | - |
| FPG46_RS09825 | 1961881..1961976 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1962004..1962063 | - | 60 | - | - | Antitoxin |
| FPG46_RS09830 | 1962099..1962200 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| FPG46_RS09835 | 1962178..1962354 | - | 177 | Protein_1888 | transposase | - |
| FPG46_RS09840 | 1962548..1962925 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1954993..1995166 | 40173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32973 WP_001801861.1 NZ_AP019751:1961881-1961976 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32973 NZ_AP019751:1961881-1961976 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT32973 NZ_AP019751:c1962063-1962004 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|