Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3642957..3643636 Replicon chromosome
Accession NZ_LT906474
Organism Escherichia coli strain NCTC122

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag CKV98_RS18565 Protein ID WP_000854680.1
Coordinates 3643295..3643636 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag CKV98_RS18560 Protein ID WP_000070396.1
Coordinates 3642957..3643274 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CKV98_RS18515 3638395..3639216 + 822 WP_000197388.1 DUF945 domain-containing protein -
CKV98_RS18520 3639433..3640134 + 702 WP_000189411.1 WYL domain-containing protein -
CKV98_RS18525 3640175..3640411 + 237 WP_001144031.1 hypothetical protein -
CKV98_RS18530 3640411..3640854 + 444 WP_000649865.1 hypothetical protein -
CKV98_RS18535 3640877..3641344 + 468 WP_001385283.1 hypothetical protein -
CKV98_RS18540 3641421..3641660 + 240 WP_000194654.1 DUF905 domain-containing protein -
CKV98_RS18545 3641758..3642216 + 459 WP_000211838.1 antirestriction protein -
CKV98_RS18550 3642232..3642708 + 477 WP_000811693.1 RadC family protein -
CKV98_RS18555 3642717..3642938 + 222 WP_000691994.1 DUF987 domain-containing protein -
CKV98_RS18560 3642957..3643274 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
CKV98_RS18565 3643295..3643636 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
CKV98_RS18575 3644208..3645461 - 1254 WP_000893272.1 glutamate-5-semialdehyde dehydrogenase -
CKV98_RS18580 3645473..3646576 - 1104 WP_001285288.1 glutamate 5-kinase -
CKV98_RS18585 3646864..3647919 + 1056 WP_045145434.1 phosphoporin PhoE -
CKV98_RS18590 3647958..3648359 - 402 WP_047402959.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 3620826..3643856 23030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T293758 WP_000854680.1 NZ_LT906474:3643295-3643636 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT293758 WP_000070396.1 NZ_LT906474:3642957-3643274 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References