293753

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2272457..2272983 Replicon chromosome
Accession NZ_LT906474
Organism Escherichia coli strain NCTC122

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag CKV98_RS11550 Protein ID WP_047402633.1
Coordinates 2272696..2272983 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S1F6D3
Locus tag CKV98_RS11545 Protein ID WP_000534858.1
Coordinates 2272457..2272696 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CKV98_RS23825 2267561..2267848 + 288 Protein_2114 hypothetical protein -
CKV98_RS11530 2269842..2271155 + 1314 WP_000589005.1 ISNCY family transposase -
CKV98_RS11535 2271592..2271924 - 333 WP_001301033.1 protein FlxA -
CKV98_RS11540 2272127..2272432 - 306 WP_001326990.1 hypothetical protein -
CKV98_RS11545 2272457..2272696 + 240 WP_000534858.1 type II toxin-antitoxin system antitoxin RelB Antitoxin
CKV98_RS11550 2272696..2272983 + 288 WP_047402633.1 type II toxin-antitoxin system mRNA interferase RelE Toxin
CKV98_RS11555 2273055..2273210 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD -
CKV98_RS11560 2273427..2273678 + 252 WP_000980994.1 hypothetical protein -
CKV98_RS11565 2273745..2274023 + 279 WP_012304870.1 hypothetical protein -
CKV98_RS11570 2274025..2275074 + 1050 WP_001265199.1 DUF968 domain-containing protein -
CKV98_RS11575 2275088..2275840 + 753 WP_001047135.1 antitermination protein -
CKV98_RS23595 2276118..2276207 - 90 WP_120795389.1 hypothetical protein -
CKV98_RS11580 2276262..2276474 - 213 WP_000087756.1 cold shock-like protein CspF -
CKV98_RS11585 2276775..2276990 + 216 WP_000066484.1 cold shock-like protein CspB -
CKV98_RS23920 2277354..2277524 - 171 WP_211180497.1 putative zinc-binding protein YnfU -
CKV98_RS11590 2277744..2277959 + 216 WP_000839590.1 phage lysis protein EssD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2248614..2294480 45866


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-79)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11224.28 Da        Isoelectric Point: 10.4221

>T293753 WP_047402633.1 NZ_LT906474:2272696-2272983 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLKSPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL

Download         Length: 288 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9071.48 Da        Isoelectric Point: 4.5230

>AT293753 WP_000534858.1 NZ_LT906474:2272457-2272696 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1CTS8

References