Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3032456..3033183 | Replicon | chromosome |
| Accession | NZ_LT827011 | ||
| Organism | Escherichia coli O127:H6 isolate EPEC E2348/69 variety | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | BQ9544_RS16385 | Protein ID | WP_000547555.1 |
| Coordinates | 3032872..3033183 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | BQ9544_RS16380 | Protein ID | WP_000126295.1 |
| Coordinates | 3032456..3032875 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ9544_RS16350 | 3028754..3029281 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| BQ9544_RS16360 | 3029815..3031188 | + | 1374 | WP_000244358.1 | IS4-like element ISEc13 family transposase | - |
| BQ9544_RS16370 | 3031326..3031784 | + | 459 | WP_000526113.1 | IS200/IS605-like element IS200C family transposase | - |
| BQ9544_RS16375 | 3031936..3032364 | + | 429 | WP_000536065.1 | DUF4259 domain-containing protein | - |
| BQ9544_RS16380 | 3032456..3032875 | - | 420 | WP_000126295.1 | helix-turn-helix domain-containing protein | Antitoxin |
| BQ9544_RS16385 | 3032872..3033183 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| BQ9544_RS16390 | 3033350..3033820 | - | 471 | WP_000132968.1 | hydrogenase maturation peptidase HycI | - |
| BQ9544_RS16395 | 3033813..3034223 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| BQ9544_RS16400 | 3034220..3034987 | - | 768 | WP_000067411.1 | formate hydrogenlyase subunit HycG | - |
| BQ9544_RS16405 | 3034987..3035529 | - | 543 | WP_000493801.1 | formate hydrogenlyase subunit HycF | - |
| BQ9544_RS16410 | 3035539..3037248 | - | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 3023673..3033183 | 9510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T293501 WP_000547555.1 NZ_LT827011:c3033183-3032872 [Escherichia coli O127:H6]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15406.38 Da Isoelectric Point: 4.4596
>AT293501 WP_000126295.1 NZ_LT827011:c3032875-3032456 [Escherichia coli O127:H6]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMSV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMSV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|