Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 323278..324069 | Replicon | chromosome |
| Accession | NZ_LT598688 | ||
| Organism | Staphylococcus aureus isolate Sa_Newman_UoM | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A380E6V7 |
| Locus tag | BN8422_RS01465 | Protein ID | WP_000525007.1 |
| Coordinates | 323278..323742 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | BN8422_RS01470 | Protein ID | WP_000333630.1 |
| Coordinates | 323755..324069 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN8422_RS01445 | 318814..320745 | + | 1932 | Protein_278 | YSIRK domain-containing triacylglycerol lipase Lip2/Geh | - |
| BN8422_RS01450 | 320839..322044 | - | 1206 | WP_000264186.1 | site-specific integrase | - |
| BN8422_RS01455 | 322155..322334 | + | 180 | WP_000337827.1 | hypothetical protein | - |
| BN8422_RS01460 | 322314..323246 | - | 933 | WP_000392183.1 | hypothetical protein | - |
| BN8422_RS01465 | 323278..323742 | - | 465 | WP_000525007.1 | hypothetical protein | Toxin |
| BN8422_RS01470 | 323755..324069 | - | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
| BN8422_RS01475 | 324221..324457 | + | 237 | WP_001121116.1 | helix-turn-helix domain-containing protein | - |
| BN8422_RS01480 | 324471..324650 | + | 180 | WP_000438352.1 | hypothetical protein | - |
| BN8422_RS01485 | 324751..325233 | - | 483 | WP_000394410.1 | hypothetical protein | - |
| BN8422_RS01490 | 325293..326042 | + | 750 | WP_001148586.1 | phage antirepressor KilAC domain-containing protein | - |
| BN8422_RS01495 | 326058..326276 | + | 219 | WP_000993180.1 | hypothetical protein | - |
| BN8422_RS01500 | 326306..326569 | + | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| BN8422_RS01505 | 326581..326742 | + | 162 | WP_000066021.1 | DUF1270 family protein | - |
| BN8422_RS01510 | 326834..327094 | + | 261 | WP_000291089.1 | DUF1108 family protein | - |
| BN8422_RS01515 | 327104..327325 | + | 222 | WP_000815401.1 | DUF2483 family protein | - |
| BN8422_RS01520 | 327318..328106 | + | 789 | WP_000134097.1 | ATP-binding protein | - |
| BN8422_RS01525 | 328135..328686 | + | 552 | WP_000704705.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 320839..363183 | 42344 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18100.42 Da Isoelectric Point: 4.7904
>T293243 WP_000525007.1 NZ_LT598688:c323742-323278 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEFSITFEPLRVFKLHHID
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEFSITFEPLRVFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380E6V7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |