Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 323278..324069 Replicon chromosome
Accession NZ_LT598688
Organism Staphylococcus aureus isolate Sa_Newman_UoM

Toxin (Protein)


Gene name - Uniprot ID A0A380E6V7
Locus tag BN8422_RS01465 Protein ID WP_000525007.1
Coordinates 323278..323742 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag BN8422_RS01470 Protein ID WP_000333630.1
Coordinates 323755..324069 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN8422_RS01445 318814..320745 + 1932 Protein_278 YSIRK domain-containing triacylglycerol lipase Lip2/Geh -
BN8422_RS01450 320839..322044 - 1206 WP_000264186.1 site-specific integrase -
BN8422_RS01455 322155..322334 + 180 WP_000337827.1 hypothetical protein -
BN8422_RS01460 322314..323246 - 933 WP_000392183.1 hypothetical protein -
BN8422_RS01465 323278..323742 - 465 WP_000525007.1 hypothetical protein Toxin
BN8422_RS01470 323755..324069 - 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
BN8422_RS01475 324221..324457 + 237 WP_001121116.1 helix-turn-helix domain-containing protein -
BN8422_RS01480 324471..324650 + 180 WP_000438352.1 hypothetical protein -
BN8422_RS01485 324751..325233 - 483 WP_000394410.1 hypothetical protein -
BN8422_RS01490 325293..326042 + 750 WP_001148586.1 phage antirepressor KilAC domain-containing protein -
BN8422_RS01495 326058..326276 + 219 WP_000993180.1 hypothetical protein -
BN8422_RS01500 326306..326569 + 264 WP_001124198.1 helix-turn-helix domain-containing protein -
BN8422_RS01505 326581..326742 + 162 WP_000066021.1 DUF1270 family protein -
BN8422_RS01510 326834..327094 + 261 WP_000291089.1 DUF1108 family protein -
BN8422_RS01515 327104..327325 + 222 WP_000815401.1 DUF2483 family protein -
BN8422_RS01520 327318..328106 + 789 WP_000134097.1 ATP-binding protein -
BN8422_RS01525 328135..328686 + 552 WP_000704705.1 single-stranded DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 320839..363183 42344


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18100.42 Da        Isoelectric Point: 4.7904

>T293243 WP_000525007.1 NZ_LT598688:c323742-323278 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEFSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT293243 WP_000333630.1 NZ_LT598688:c324069-323755 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380E6V7

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References