Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1857938..1858544 | Replicon | chromosome |
| Accession | NZ_LT549890 | ||
| Organism | Saccharolobus solfataricus strain P1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q97WY9 |
| Locus tag | SSOP1_RS10015 | Protein ID | WP_009991922.1 |
| Coordinates | 1858152..1858544 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C3NC15 |
| Locus tag | SSOP1_RS10010 | Protein ID | WP_009991920.1 |
| Coordinates | 1857938..1858162 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSOP1_RS09975 (SSOP1_2094) | 1853173..1854123 | - | 951 | WP_010923701.1 | IS110 family transposase | - |
| SSOP1_RS09980 (SSOP1_2095) | 1854282..1854566 | + | 285 | Protein_2005 | IS607-like element ISC1913 family transposase | - |
| SSOP1_RS09985 (SSOP1_2096) | 1854550..1855770 | + | 1221 | WP_014511730.1 | IS200/IS605 family accessory protein TnpB-related protein | - |
| SSOP1_RS09990 (SSOP1_2097) | 1855918..1856304 | - | 387 | WP_009991912.1 | type II toxin-antitoxin system VapC family toxin | - |
| SSOP1_RS09995 (SSOP1_2098) | 1856291..1856566 | - | 276 | WP_009991915.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| SSOP1_RS10000 (SSOP1_2099) | 1856937..1857173 | + | 237 | WP_009991916.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| SSOP1_RS10005 (SSOP1_2100) | 1857151..1857549 | + | 399 | WP_009991918.1 | type II toxin-antitoxin system VapC family toxin | - |
| SSOP1_RS10010 (SSOP1_2101) | 1857938..1858162 | + | 225 | WP_009991920.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| SSOP1_RS10015 (SSOP1_2102) | 1858152..1858544 | + | 393 | WP_009991922.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SSOP1_RS10020 | 1858718..1859663 | + | 946 | Protein_2013 | IS110 family transposase | - |
| SSOP1_RS10025 (SSOP1_2105) | 1859767..1860915 | - | 1149 | WP_010923706.1 | RNA-guided endonuclease TnpB family protein | - |
| SSOP1_RS10030 (SSOP1_2106) | 1861192..1861569 | - | 378 | WP_009989379.1 | type II toxin-antitoxin system VapC family toxin | - |
| SSOP1_RS10035 (SSOP1_2107) | 1861535..1861789 | - | 255 | WP_009989377.1 | antitoxin VapB family protein | - |
| SSOP1_RS10040 (SSOP1_2108) | 1862018..1862362 | - | 345 | WP_009989373.1 | heavy metal-binding domain-containing protein | - |
| SSOP1_RS10045 (SSOP1_2109) | 1862666..1863064 | - | 399 | WP_009989371.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | IScluster/Tn | - | - | 1852741..1865437 | 12696 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 15105.86 Da Isoelectric Point: 8.2957
>T293131 WP_009991922.1 NZ_LT549890:1858152-1858544 [Saccharolobus solfataricus]
MKDKEFLFDASALYSLLDYVDKIDLKKIHILTLTFYEVGNVIWKEYYIHKKVKDPITLSMLFHKLMRKLNIVEDPPLEGV
MRIAVERGLTYYDASYAYVAESLGLILVSNDKELIRKANAISLKDLIKSM
MKDKEFLFDASALYSLLDYVDKIDLKKIHILTLTFYEVGNVIWKEYYIHKKVKDPITLSMLFHKLMRKLNIVEDPPLEGV
MRIAVERGLTYYDASYAYVAESLGLILVSNDKELIRKANAISLKDLIKSM
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E3K6Y2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E3MHL6 |