293131

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 1857938..1858544 Replicon chromosome
Accession NZ_LT549890
Organism Saccharolobus solfataricus strain P1

Toxin (Protein)


Gene name vapC Uniprot ID Q97WY9
Locus tag SSOP1_RS10015 Protein ID WP_009991922.1
Coordinates 1858152..1858544 (+) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID C3NC15
Locus tag SSOP1_RS10010 Protein ID WP_009991920.1
Coordinates 1857938..1858162 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SSOP1_RS09975 (SSOP1_2094) 1853173..1854123 - 951 WP_010923701.1 IS110 family transposase -
SSOP1_RS09980 (SSOP1_2095) 1854282..1854566 + 285 Protein_2005 IS607-like element ISC1913 family transposase -
SSOP1_RS09985 (SSOP1_2096) 1854550..1855770 + 1221 WP_014511730.1 IS200/IS605 family accessory protein TnpB-related protein -
SSOP1_RS09990 (SSOP1_2097) 1855918..1856304 - 387 WP_009991912.1 type II toxin-antitoxin system VapC family toxin -
SSOP1_RS09995 (SSOP1_2098) 1856291..1856566 - 276 WP_009991915.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
SSOP1_RS10000 (SSOP1_2099) 1856937..1857173 + 237 WP_009991916.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
SSOP1_RS10005 (SSOP1_2100) 1857151..1857549 + 399 WP_009991918.1 type II toxin-antitoxin system VapC family toxin -
SSOP1_RS10010 (SSOP1_2101) 1857938..1858162 + 225 WP_009991920.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
SSOP1_RS10015 (SSOP1_2102) 1858152..1858544 + 393 WP_009991922.1 type II toxin-antitoxin system VapC family toxin Toxin
SSOP1_RS10020 1858718..1859663 + 946 Protein_2013 IS110 family transposase -
SSOP1_RS10025 (SSOP1_2105) 1859767..1860915 - 1149 WP_010923706.1 RNA-guided endonuclease TnpB family protein -
SSOP1_RS10030 (SSOP1_2106) 1861192..1861569 - 378 WP_009989379.1 type II toxin-antitoxin system VapC family toxin -
SSOP1_RS10035 (SSOP1_2107) 1861535..1861789 - 255 WP_009989377.1 antitoxin VapB family protein -
SSOP1_RS10040 (SSOP1_2108) 1862018..1862362 - 345 WP_009989373.1 heavy metal-binding domain-containing protein -
SSOP1_RS10045 (SSOP1_2109) 1862666..1863064 - 399 WP_009989371.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside IScluster/Tn - - 1852741..1865437 12696


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(23-118)

Antitoxin

Post-segregation antitoxin CcdA

(5-44)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 15105.86 Da        Isoelectric Point: 8.2957

>T293131 WP_009991922.1 NZ_LT549890:1858152-1858544 [Saccharolobus solfataricus]
MKDKEFLFDASALYSLLDYVDKIDLKKIHILTLTFYEVGNVIWKEYYIHKKVKDPITLSMLFHKLMRKLNIVEDPPLEGV
MRIAVERGLTYYDASYAYVAESLGLILVSNDKELIRKANAISLKDLIKSM

Download         Length: 393 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8881.24 Da        Isoelectric Point: 5.0355

>AT293131 WP_009991920.1 NZ_LT549890:1857938-1858162 [Saccharolobus solfataricus]
MSDVISVRVKKELKKRAEELGINIREVVEKALEEAIREKEKEELKDIVMRIKELMRDVSEDDWVRAVRESRDER

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E3K6Y2

Antitoxin

Source ID Structure
AlphaFold DB A0A0E3MHL6

References