Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1893248..1893428 Replicon chromosome
Accession NZ_LT009690
Organism Staphylococcus aureus strain NZAK3

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag NZAK3_RS15275 Protein ID WP_001801861.1
Coordinates 1893248..1893343 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1893371..1893428 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZAK3_RS09345 1888411..1889061 + 651 WP_001795210.1 excalibur calcium-binding domain-containing protein -
NZAK3_RS09350 1889142..1890137 + 996 WP_000070642.1 DUF4352 domain-containing protein -
NZAK3_RS09355 1890212..1890838 + 627 WP_000669024.1 hypothetical protein -
NZAK3_RS09360 1890879..1891220 + 342 WP_000627540.1 DUF3969 family protein -
NZAK3_RS09365 1891321..1891893 + 573 WP_000414216.1 hypothetical protein -
NZAK3_RS14905 1892091..1893103 - 1013 Protein_1800 IS3 family transposase -
NZAK3_RS15275 1893248..1893343 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1893371..1893428 - 58 - - Antitoxin
NZAK3_RS09385 1893466..1893567 + 102 WP_001792025.1 hypothetical protein -
NZAK3_RS15280 1893545..1893706 - 162 Protein_1803 transposase -
NZAK3_RS09390 1893697..1894191 - 495 Protein_1804 transposase -
NZAK3_RS09395 1894643..1895872 - 1230 Protein_1805 restriction endonuclease subunit S -
NZAK3_RS09400 1895865..1897421 - 1557 WP_000028669.1 type I restriction-modification system subunit M -
NZAK3_RS09405 1897585..1897719 - 135 WP_001791797.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA / selk 1887653..1920261 32608
- inside Prophage - lukD / hlgA / selk 1869230..1967977 98747


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T293101 WP_001801861.1 NZ_LT009690:1893248-1893343 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT293101 NZ_LT009690:c1893428-1893371 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References