Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1841432..1841614 | Replicon | chromosome |
| Accession | NZ_LS483365 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQM91_RS09325 | Protein ID | WP_001801861.1 |
| Coordinates | 1841432..1841527 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1841555..1841614 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM91_RS09275 | 1837092..1837718 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| DQM91_RS09280 | 1837759..1838103 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| DQM91_RS09285 | 1838201..1838752 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| DQM91_RS09290 | 1838970..1839611 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM91_RS09295 | 1839725..1839910 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| DQM91_RS09300 | 1839912..1840088 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| DQM91_RS09305 | 1840099..1840482 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| DQM91_RS09315 | 1841086..1841229 | - | 144 | WP_001549059.1 | transposase | - |
| DQM91_RS09325 | 1841432..1841527 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1841555..1841614 | - | 60 | - | - | Antitoxin |
| DQM91_RS09330 | 1841650..1841751 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| DQM91_RS09335 | 1841729..1841905 | - | 177 | Protein_1754 | transposase | - |
| DQM91_RS09340 | 1842099..1842476 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1834532..1874703 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292432 WP_001801861.1 NZ_LS483365:1841432-1841527 [Staphylococcus aureus subsp. aureus NCTC 8325]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT292432 NZ_LS483365:c1841614-1841555 [Staphylococcus aureus subsp. aureus NCTC 8325]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|