Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1841432..1841614 Replicon chromosome
Accession NZ_LS483365
Organism Staphylococcus aureus subsp. aureus NCTC 8325

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQM91_RS09325 Protein ID WP_001801861.1
Coordinates 1841432..1841527 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1841555..1841614 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM91_RS09275 1837092..1837718 + 627 WP_000669046.1 hypothetical protein -
DQM91_RS09280 1837759..1838103 + 345 WP_000627551.1 DUF3969 family protein -
DQM91_RS09285 1838201..1838752 + 552 WP_000414205.1 hypothetical protein -
DQM91_RS09290 1838970..1839611 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
DQM91_RS09295 1839725..1839910 - 186 WP_000809857.1 hypothetical protein -
DQM91_RS09300 1839912..1840088 - 177 WP_000375476.1 hypothetical protein -
DQM91_RS09305 1840099..1840482 - 384 WP_000070812.1 hypothetical protein -
DQM91_RS09315 1841086..1841229 - 144 WP_001549059.1 transposase -
DQM91_RS09325 1841432..1841527 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1841555..1841614 - 60 - - Antitoxin
DQM91_RS09330 1841650..1841751 + 102 WP_001791893.1 hypothetical protein -
DQM91_RS09335 1841729..1841905 - 177 Protein_1754 transposase -
DQM91_RS09340 1842099..1842476 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1834532..1874703 40171


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292432 WP_001801861.1 NZ_LS483365:1841432-1841527 [Staphylococcus aureus subsp. aureus NCTC 8325]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT292432 NZ_LS483365:c1841614-1841555 [Staphylococcus aureus subsp. aureus NCTC 8325]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References