Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1860356..1860538 | Replicon | chromosome |
Accession | NZ_LS483350 | ||
Organism | Staphylococcus aureus strain NCTC11940 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DQM92_RS09335 | Protein ID | WP_001801861.1 |
Coordinates | 1860356..1860451 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1860479..1860538 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM92_RS09285 | 1856016..1856642 | + | 627 | WP_000669046.1 | hypothetical protein | - |
DQM92_RS09290 | 1856683..1857027 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
DQM92_RS09295 | 1857125..1857676 | + | 552 | WP_000414205.1 | hypothetical protein | - |
DQM92_RS09300 | 1857894..1858535 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
DQM92_RS09305 | 1858649..1858834 | - | 186 | WP_000809857.1 | hypothetical protein | - |
DQM92_RS09310 | 1858836..1859012 | - | 177 | WP_000375476.1 | hypothetical protein | - |
DQM92_RS09315 | 1859023..1859406 | - | 384 | WP_000070811.1 | hypothetical protein | - |
DQM92_RS09325 | 1860010..1860153 | - | 144 | WP_001549059.1 | transposase | - |
DQM92_RS09335 | 1860356..1860451 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1860479..1860538 | - | 60 | - | - | Antitoxin |
DQM92_RS09340 | 1860574..1860675 | + | 102 | WP_001791893.1 | hypothetical protein | - |
DQM92_RS09345 | 1860653..1860829 | - | 177 | Protein_1755 | transposase | - |
DQM92_RS09350 | 1861023..1861400 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1853456..1892375 | 38919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292399 WP_001801861.1 NZ_LS483350:1860356-1860451 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT292399 NZ_LS483350:c1860538-1860479 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|