Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1860356..1860538 Replicon chromosome
Accession NZ_LS483350
Organism Staphylococcus aureus strain NCTC11940

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQM92_RS09335 Protein ID WP_001801861.1
Coordinates 1860356..1860451 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1860479..1860538 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM92_RS09285 1856016..1856642 + 627 WP_000669046.1 hypothetical protein -
DQM92_RS09290 1856683..1857027 + 345 WP_000627551.1 DUF3969 family protein -
DQM92_RS09295 1857125..1857676 + 552 WP_000414205.1 hypothetical protein -
DQM92_RS09300 1857894..1858535 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
DQM92_RS09305 1858649..1858834 - 186 WP_000809857.1 hypothetical protein -
DQM92_RS09310 1858836..1859012 - 177 WP_000375476.1 hypothetical protein -
DQM92_RS09315 1859023..1859406 - 384 WP_000070811.1 hypothetical protein -
DQM92_RS09325 1860010..1860153 - 144 WP_001549059.1 transposase -
DQM92_RS09335 1860356..1860451 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1860479..1860538 - 60 - - Antitoxin
DQM92_RS09340 1860574..1860675 + 102 WP_001791893.1 hypothetical protein -
DQM92_RS09345 1860653..1860829 - 177 Protein_1755 transposase -
DQM92_RS09350 1861023..1861400 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1853456..1892375 38919


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292399 WP_001801861.1 NZ_LS483350:1860356-1860451 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT292399 NZ_LS483350:c1860538-1860479 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References