Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1868521..1868703 Replicon chromosome
Accession NZ_LS483316
Organism Staphylococcus aureus strain NCTC13395

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQL73_RS09365 Protein ID WP_001801861.1
Coordinates 1868521..1868616 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1868644..1868703 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL73_RS09315 1864181..1864807 + 627 WP_000669046.1 hypothetical protein -
DQL73_RS09320 1864848..1865192 + 345 WP_000627551.1 DUF3969 family protein -
DQL73_RS09325 1865290..1865841 + 552 WP_000414205.1 hypothetical protein -
DQL73_RS09330 1866059..1866700 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
DQL73_RS09335 1866814..1866999 - 186 WP_000809857.1 hypothetical protein -
DQL73_RS09340 1867001..1867177 - 177 WP_000375476.1 hypothetical protein -
DQL73_RS09345 1867188..1867571 - 384 WP_000070811.1 hypothetical protein -
DQL73_RS09355 1868175..1868318 - 144 WP_001549059.1 transposase -
DQL73_RS09365 1868521..1868616 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1868644..1868703 - 60 - - Antitoxin
DQL73_RS09370 1868739..1868840 + 102 WP_001791893.1 hypothetical protein -
DQL73_RS09375 1868818..1868994 - 177 Protein_1752 transposase -
DQL73_RS09380 1869188..1869565 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / lukD / hlgA 1861621..1901793 40172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292317 WP_001801861.1 NZ_LS483316:1868521-1868616 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT292317 NZ_LS483316:c1868703-1868644 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References