Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1868521..1868703 | Replicon | chromosome |
Accession | NZ_LS483316 | ||
Organism | Staphylococcus aureus strain NCTC13395 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DQL73_RS09365 | Protein ID | WP_001801861.1 |
Coordinates | 1868521..1868616 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1868644..1868703 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL73_RS09315 | 1864181..1864807 | + | 627 | WP_000669046.1 | hypothetical protein | - |
DQL73_RS09320 | 1864848..1865192 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
DQL73_RS09325 | 1865290..1865841 | + | 552 | WP_000414205.1 | hypothetical protein | - |
DQL73_RS09330 | 1866059..1866700 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
DQL73_RS09335 | 1866814..1866999 | - | 186 | WP_000809857.1 | hypothetical protein | - |
DQL73_RS09340 | 1867001..1867177 | - | 177 | WP_000375476.1 | hypothetical protein | - |
DQL73_RS09345 | 1867188..1867571 | - | 384 | WP_000070811.1 | hypothetical protein | - |
DQL73_RS09355 | 1868175..1868318 | - | 144 | WP_001549059.1 | transposase | - |
DQL73_RS09365 | 1868521..1868616 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1868644..1868703 | - | 60 | - | - | Antitoxin |
DQL73_RS09370 | 1868739..1868840 | + | 102 | WP_001791893.1 | hypothetical protein | - |
DQL73_RS09375 | 1868818..1868994 | - | 177 | Protein_1752 | transposase | - |
DQL73_RS09380 | 1869188..1869565 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / lukD / hlgA | 1861621..1901793 | 40172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292317 WP_001801861.1 NZ_LS483316:1868521-1868616 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT292317 NZ_LS483316:c1868703-1868644 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|