Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4131902..4132716 | Replicon | chromosome |
Accession | NZ_LR890603 | ||
Organism | Escherichia coli isolate MSB1_8G-sc-2280388 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | JMW40_RS19630 | Protein ID | WP_001054376.1 |
Coordinates | 4131902..4132159 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | JMW40_RS19635 | Protein ID | WP_001309181.1 |
Coordinates | 4132171..4132716 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW40_RS19610 | 4127162..4128142 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
JMW40_RS19615 | 4128757..4129773 | - | 1017 | WP_001322394.1 | IS5-like element IS5 family transposase | - |
JMW40_RS19620 | 4129924..4131164 | - | 1241 | Protein_3833 | DNA helicase | - |
JMW40_RS19625 | 4131280..4131525 | + | 246 | Protein_3834 | GNAT family N-acetyltransferase | - |
JMW40_RS19630 | 4131902..4132159 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
JMW40_RS19635 | 4132171..4132716 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
JMW40_RS19640 | 4132772..4133518 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
JMW40_RS19645 | 4133687..4133905 | + | 219 | Protein_3838 | hypothetical protein | - |
JMW40_RS19650 | 4133943..4134059 | + | 117 | Protein_3839 | VOC family protein | - |
JMW40_RS19655 | 4134304..4135425 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
JMW40_RS19660 | 4135422..4135700 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
JMW40_RS19665 | 4135712..4137025 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4120489..4140940 | 20451 | |
flank | IS/Tn | - | - | 4128757..4129737 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T291532 WP_001054376.1 NZ_LR890603:4131902-4132159 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT291532 WP_001309181.1 NZ_LR890603:4132171-4132716 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|