Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4438407..4439221 | Replicon | chromosome |
Accession | NZ_LR890405 | ||
Organism | Escherichia coli isolate MSB1_7C-sc-2280317 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | JMW09_RS21280 | Protein ID | WP_001054376.1 |
Coordinates | 4438407..4438664 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | JMW09_RS21285 | Protein ID | WP_001309181.1 |
Coordinates | 4438676..4439221 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW09_RS21260 | 4433667..4434647 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
JMW09_RS21265 | 4435262..4436278 | - | 1017 | WP_001322394.1 | IS5-like element IS5 family transposase | - |
JMW09_RS21270 | 4436429..4437669 | - | 1241 | Protein_4165 | DNA helicase | - |
JMW09_RS21275 | 4437785..4438030 | + | 246 | Protein_4166 | GNAT family N-acetyltransferase | - |
JMW09_RS21280 | 4438407..4438664 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
JMW09_RS21285 | 4438676..4439221 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
JMW09_RS21290 | 4439277..4440023 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
JMW09_RS21295 | 4440192..4440410 | + | 219 | Protein_4170 | hypothetical protein | - |
JMW09_RS21300 | 4440448..4440564 | + | 117 | Protein_4171 | VOC family protein | - |
JMW09_RS21305 | 4440809..4441930 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
JMW09_RS21310 | 4441927..4442205 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
JMW09_RS21315 | 4442217..4443530 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4429702..4447445 | 17743 | |
flank | IS/Tn | - | - | 4435262..4436242 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T290904 WP_001054376.1 NZ_LR890405:4438407-4438664 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT290904 WP_001309181.1 NZ_LR890405:4438676-4439221 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|