Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 4562993..4563405 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | IEU92_RS21965 | Protein ID | WP_000132601.1 |
| Coordinates | 4562993..4563334 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4563329..4563405 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS21955 | 4560406..4561452 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| IEU92_RS21960 | 4561452..4562831 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| IEU92_RS21965 | 4562993..4563334 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| - | 4563329..4563405 | + | 77 | NuclAT_14 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_14 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_14 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_14 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_15 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_15 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_15 | - | Antitoxin |
| - | 4563329..4563405 | + | 77 | NuclAT_15 | - | Antitoxin |
| IEU92_RS21970 | 4563562..4564956 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
| IEU92_RS21975 | 4564953..4566542 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 4555908..4564956 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T289532 WP_000132601.1 NZ_LR881938:c4563334-4562993 [Escherichia coli str. K-12 substr. MG1655]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT289532 NZ_LR881938:4563329-4563405 [Escherichia coli str. K-12 substr. MG1655]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|