Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3520055..3520770 | Replicon | chromosome |
Accession | NZ_LR878365 | ||
Organism | Shigella flexneri 3a isolate 83 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A658YZ27 |
Locus tag | JMV05_RS17980 | Protein ID | WP_001263492.1 |
Coordinates | 3520055..3520474 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | Q0T7Q4 |
Locus tag | JMV05_RS17985 | Protein ID | WP_000554759.1 |
Coordinates | 3520477..3520770 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV05_RS17955 (3515358) | 3515358..3516815 | + | 1458 | WP_025759252.1 | cytosol nonspecific dipeptidase | - |
JMV05_RS17960 (3516872) | 3516872..3517432 | - | 561 | Protein_3507 | peptide chain release factor H | - |
JMV05_RS17965 (3517548) | 3517548..3518592 | - | 1045 | Protein_3508 | RNA ligase RtcB family protein | - |
JMV05_RS17970 (3518838) | 3518838..3519290 | - | 453 | WP_001059862.1 | GNAT family N-acetyltransferase | - |
JMV05_RS17980 (3520055) | 3520055..3520474 | - | 420 | WP_001263492.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
JMV05_RS17985 (3520477) | 3520477..3520770 | - | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
JMV05_RS17990 (3520822) | 3520822..3521877 | - | 1056 | WP_001226172.1 | DNA polymerase IV | - |
JMV05_RS17995 (3521948) | 3521948..3522733 | - | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
JMV05_RS18000 (3522705) | 3522705..3524417 | + | 1713 | Protein_3515 | flagellar biosynthesis protein FlhA | - |
JMV05_RS18005 (3524634) | 3524634..3525131 | - | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | gtrB / gtrB / gmhA/lpcA | 3458709..3556366 | 97657 | |
flank | IS/Tn | - | - | 3519324..3519827 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16348.95 Da Isoelectric Point: 8.0871
>T289456 WP_001263492.1 NZ_LR878365:c3520474-3520055 [Shigella flexneri 3a]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRFWVMLPTY
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRFWVMLPTY
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A658YZ27 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TR46 |