Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 174580..174760 | Replicon | chromosome |
| Accession | NZ_LR822061 | ||
| Organism | Staphylococcus aureus isolate HU-14 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | BKMNNEJI_RS01090 | Protein ID | WP_001801861.1 |
| Coordinates | 174665..174760 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 174580..174637 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BKMNNEJI_RS01060 | 170289..170423 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| BKMNNEJI_RS01065 | 170587..172143 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| BKMNNEJI_RS01070 | 172136..173365 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| BKMNNEJI_RS01075 | 173817..174311 | + | 495 | Protein_175 | transposase | - |
| BKMNNEJI_RS01080 | 174302..174463 | + | 162 | Protein_176 | transposase | - |
| BKMNNEJI_RS01085 | 174441..174542 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 174580..174637 | + | 58 | - | - | Antitoxin |
| BKMNNEJI_RS01090 | 174665..174760 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| BKMNNEJI_RS01095 | 174905..175917 | + | 1013 | Protein_179 | IS3 family transposase | - |
| BKMNNEJI_RS01100 | 176115..176687 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| BKMNNEJI_RS01105 | 176788..177129 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| BKMNNEJI_RS01110 | 177170..177796 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| BKMNNEJI_RS01115 | 177871..178803 | - | 933 | WP_078066154.1 | DUF4352 domain-containing protein | - |
| BKMNNEJI_RS01120 | 179271..179726 | + | 456 | WP_012840523.1 | DUF4909 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selq / selk / hlgA / lukD | 147749..175917 | 28168 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T289409 WP_001801861.1 NZ_LR822061:c174760-174665 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT289409 NZ_LR822061:174580-174637 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|