Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 174580..174760 Replicon chromosome
Accession NZ_LR822061
Organism Staphylococcus aureus isolate HU-14

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag BKMNNEJI_RS01090 Protein ID WP_001801861.1
Coordinates 174665..174760 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 174580..174637 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKMNNEJI_RS01060 170289..170423 + 135 WP_001791797.1 hypothetical protein -
BKMNNEJI_RS01065 170587..172143 + 1557 WP_000028669.1 type I restriction-modification system subunit M -
BKMNNEJI_RS01070 172136..173365 + 1230 WP_000072627.1 restriction endonuclease subunit S -
BKMNNEJI_RS01075 173817..174311 + 495 Protein_175 transposase -
BKMNNEJI_RS01080 174302..174463 + 162 Protein_176 transposase -
BKMNNEJI_RS01085 174441..174542 - 102 WP_001792025.1 hypothetical protein -
- 174580..174637 + 58 - - Antitoxin
BKMNNEJI_RS01090 174665..174760 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
BKMNNEJI_RS01095 174905..175917 + 1013 Protein_179 IS3 family transposase -
BKMNNEJI_RS01100 176115..176687 - 573 WP_000414216.1 hypothetical protein -
BKMNNEJI_RS01105 176788..177129 - 342 WP_000627540.1 DUF3969 family protein -
BKMNNEJI_RS01110 177170..177796 - 627 WP_000669024.1 hypothetical protein -
BKMNNEJI_RS01115 177871..178803 - 933 WP_078066154.1 DUF4352 domain-containing protein -
BKMNNEJI_RS01120 179271..179726 + 456 WP_012840523.1 DUF4909 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - selq / selk / hlgA / lukD 147749..175917 28168


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T289409 WP_001801861.1 NZ_LR822061:c174760-174665 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT289409 NZ_LR822061:174580-174637 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References