Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1564529..1565095 | Replicon | chromosome |
Accession | NZ_LR698953 | ||
Organism | Bifidobacterium longum isolate MGYG-HGUT-01292 |
Toxin (Protein)
Gene name | relE | Uniprot ID | W6EX94 |
Locus tag | FXZ20_RS07690 | Protein ID | WP_003831807.1 |
Coordinates | 1564802..1565095 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FXZ20_RS07685 | Protein ID | WP_014484914.1 |
Coordinates | 1564529..1564798 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXZ20_RS07660 | 1560279..1560973 | - | 695 | Protein_1417 | response regulator transcription factor | - |
FXZ20_RS07665 | 1561099..1561614 | + | 516 | WP_013140733.1 | hypothetical protein | - |
FXZ20_RS07670 | 1561611..1562501 | + | 891 | WP_014484913.1 | hypothetical protein | - |
FXZ20_RS07675 | 1562498..1563178 | + | 681 | WP_003829413.1 | ABC transporter ATP-binding protein | - |
FXZ20_RS07680 | 1563175..1564344 | + | 1170 | WP_012577732.1 | ABC transporter permease | - |
FXZ20_RS07685 | 1564529..1564798 | + | 270 | WP_014484914.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FXZ20_RS07690 | 1564802..1565095 | + | 294 | WP_003831807.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FXZ20_RS07695 | 1565153..1565433 | + | 281 | Protein_1424 | hypothetical protein | - |
FXZ20_RS07700 | 1565764..1566315 | + | 552 | WP_012577735.1 | RNA polymerase sigma factor | - |
FXZ20_RS07705 | 1566349..1567176 | + | 828 | WP_012577736.1 | hypothetical protein | - |
FXZ20_RS07710 | 1567308..1567934 | + | 627 | WP_012577737.1 | hypothetical protein | - |
FXZ20_RS07715 | 1567931..1568713 | + | 783 | WP_012577738.1 | hypothetical protein | - |
FXZ20_RS07720 | 1568766..1569641 | + | 876 | WP_003829425.1 | ABC transporter ATP-binding protein | - |
FXZ20_RS07725 | 1569695..1570093 | + | 399 | WP_003829426.1 | superoxide dismutase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1555544..1576902 | 21358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11218.98 Da Isoelectric Point: 9.7881
>T288685 WP_003831807.1 NZ_LR698953:1564802-1565095 [Bifidobacterium longum]
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEVLRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEVLRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|