Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1524365..1524931 Replicon chromosome
Accession NZ_LR655210
Organism Bifidobacterium longum subsp. infantis isolate B.longum_ssp_infantis_6

Toxin (Protein)


Gene name relE Uniprot ID W6EX94
Locus tag BILO16373828_RS07110 Protein ID WP_003831807.1
Coordinates 1524365..1524658 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag BILO16373828_RS07115 Protein ID WP_014484914.1
Coordinates 1524662..1524931 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BILO16373828_RS07075 1519367..1519765 - 399 WP_003829426.1 superoxide dismutase -
BILO16373828_RS07080 1519819..1520694 - 876 WP_003829425.1 ABC transporter ATP-binding protein -
BILO16373828_RS07085 1520747..1521529 - 783 WP_012577738.1 hypothetical protein -
BILO16373828_RS07090 1521526..1522152 - 627 WP_012577737.1 hypothetical protein -
BILO16373828_RS07095 1522284..1523111 - 828 WP_012577736.1 hypothetical protein -
BILO16373828_RS07100 1523145..1523696 - 552 WP_012577735.1 RNA polymerase sigma factor -
BILO16373828_RS07105 1524027..1524307 - 281 Protein_1326 hypothetical protein -
BILO16373828_RS07110 1524365..1524658 - 294 WP_003831807.1 type II toxin-antitoxin system YafQ family toxin Toxin
BILO16373828_RS07115 1524662..1524931 - 270 WP_014484914.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
BILO16373828_RS07120 1525116..1526285 - 1170 WP_012577732.1 ABC transporter permease -
BILO16373828_RS07125 1526282..1526962 - 681 WP_003829413.1 ABC transporter ATP-binding protein -
BILO16373828_RS07130 1526959..1527849 - 891 WP_014484913.1 hypothetical protein -
BILO16373828_RS07135 1527846..1528361 - 516 WP_013140733.1 hypothetical protein -
BILO16373828_RS07140 1528487..1529181 + 695 Protein_1333 response regulator transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 1507377..1535379 28002


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-95)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-87)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11218.98 Da        Isoelectric Point: 9.7881

>T288655 WP_003831807.1 NZ_LR655210:c1524658-1524365 [Bifidobacterium longum subsp. infantis]
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEVLRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK

Download         Length: 294 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 9902.25 Da        Isoelectric Point: 4.7872

>AT288655 WP_014484914.1 NZ_LR655210:c1524931-1524662 [Bifidobacterium longum subsp. infantis]
VSMASVTVRVDADTKQKAANIAEDLGLDLSSVTRAFYKQIVRERRIPLNLSYTTVPPETMEALDEAKNRLADGKPRFNSA
DEMFDSLVI

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W6EX94

Antitoxin

Source ID Structure

References